KEGG   Corynebacterium glutamicum K051: WA5_2126Help
Entry
WA5_2126          CDS       T02508                                 

Gene name
SucB
Definition
(GenBank) dihydrolipoamide acetyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cgu  Corynebacterium glutamicum K051
Pathway
cgu00020  Citrate cycle (TCA cycle)
cgu00310  Lysine degradation
cgu00380  Tryptophan metabolism
cgu01100  Metabolic pathways
cgu01110  Biosynthesis of secondary metabolites
cgu01120  Microbial metabolism in diverse environments
cgu01130  Biosynthesis of antibiotics
cgu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cgu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    WA5_2126 (SucB)
  09105 Amino acid metabolism
   00310 Lysine degradation
    WA5_2126 (SucB)
   00380 Tryptophan metabolism
    WA5_2126 (SucB)
Enzymes [BR:cgu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     WA5_2126 (SucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H HlyD_3 DUF2254
Motif
Other DBs
NCBI-ProteinID: CCH25346
Position
2339269..2341296
Genome map
AA seq 675 aa AA seqDB search
MAFSVEMPELGESVTEGTITQWLKSVGDTVEVDEPLLEVSTDKVDTEIPSPVAGVILEIK
AEEDDTVDVGGVIAIIGDADETPANEAPADEAPAPAEEEEPVKEEPKKEAAPEAPAATGA
ATDVEMPELGESVTEGTITQWLKAVGDTVEVDEPLLEVSTDKVDTEIPSPVAGTIVEILA
DEDDTVDVGAVIARIGDANAAAAPAEEEAAPAEEEEPVKEEPKKEAAPEAPAATGAATDV
EMPELGESVTEGTITQWLKAVGDTVEVDEPLLEVSTDKVDTEIPSPVAGTIVEILADEDD
TVDVGAVIARIGDANAAAAPAEEEAAPAEEEEPVKEEPKKEEPKKEEPKKEAATTPAAAS
ATVSASGDNVPYVTPLVRKLAEKHGVDLNTVTGTGIGGRIRKQDVLAAANGEAAPAEAAA
PVSAWSTKSVDPEKAKLRGTTQKVNRIREITAMKTVEALQISAQLTQLHEVDMTRVAELR
KKNKPAFIEKHGVNLTYLPFFVKAVVEALVSHPNVNASFNAKTKEMTYHSSVNLSIAVDT
PAGLLTPVIHDAQDLSIPEIAKAIVDLADRSRNNKLKPNDLSGGTFTITNIGSEGALSDT
PILVPPQAGILGTGAIVKRPVVITEDGIDSIAIRQMVFLPLTYDHQVVDGADAGRFLTTI
KDRLETANFEGDLQL
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
atggcgttctccgtagagatgcccgagctgggcgaatcagtaaccgaaggcacgatcacc
cagtggttgaagtctgttggtgacactgttgaggtagatgagccgttgctcgaggtctca
actgacaaggtcgacaccgagattccctctcctgtcgccggtgtcatcctagagattaag
gctgaagaggatgacaccgtcgacgtcggcggtgtcattgcaataatcggcgatgctgat
gagactcctgccaacgaagctcctgccgacgaggcaccagctcctgccgaagaggaagaa
ccagttaaggaagagccaaagaaggaggcagctcctgaagctccagcagcaactggcgcc
gcaaccgatgtggaaatgccagaactcggcgaatccgtcaccgaaggcaccattacccag
tggctcaaggctgtcggcgacaccgtcgaagtagacgaaccacttcttgaggtctccacc
gacaaggtcgacaccgaaatcccatccccagtagcaggcaccatcgtggagatccttgca
gacgaagacgacaccgtcgacgtcggcgcagtcatcgcccgcatcggtgacgcaaacgca
gctgcagcacctgccgaagaggaagcagctcctgccgaagaggaagaaccagttaaggaa
gagccaaagaaggaggcagctcctgaagctccagcagcaactggcgccgcaaccgatgtg
gaaatgccagaactcggcgaatccgtcaccgaaggcaccattacccagtggctcaaggct
gtcggcgacaccgtcgaagtagacgaaccacttcttgaggtctccaccgacaaggtcgac
accgaaatcccatccccagtagcaggcaccatcgtggagatccttgcagacgaagacgac
accgtcgacgtcggcgcagtcatcgcccgcatcggtgacgcaaacgcagctgcagcacct
gccgaagaggaagcagctcctgccgaagaggaggaaccagttaaggaagagccaaagaag
gaagagcccaagaaggaagagcccaagaaggaagcagctactacacctgctgcggcatcc
gcaactgtgtccgcttctggcgacaacgttccatacgtcaccccactggtgcgcaagctt
gctgaaaagcacggcgttgacttgaacaccgtgaccggtaccggtatcggtggccgtatc
cgcaagcaggatgttttggctgctgcgaacggcgaggctgcacctgctgaggctgctgct
cctgtttccgcttggtccactaagtctgttgaccctgagaaggctaagctccgtggtacc
actcagaaggtcaaccgcatccgtgagatcaccgcgatgaagaccgtcgaggctctgcag
atttctgctcagctcacccagctgcacgaggtcgatatgactcgcgttgctgagctgcgt
aagaagaacaagcccgcgttcatcgagaagcacggtgtgaacctcacttacctgccattc
ttcgtgaaggcagttgtcgaggctttggtttcccatccaaacgtcaacgcgtctttcaac
gcgaagaccaaggagatgacctaccactcctccgttaacctctccatcgctgttgatacc
ccagctggtctgttgaccccagtcattcacgatgctcaggatctctccatcccagagatc
gcaaaggcaattgttgacctggctgatcgttcacgcaacaacaagctgaagccaaacgat
ctgtccggtggcaccttcaccatcaccaacattggttctgaaggcgcactgtctgatacc
ccaatcctggttccaccacaggctggcatcttgggcaccggcgcgatcgtgaagcgtcca
gttgtcatcaccgaggatggaattgattccatcgcgatccgtcagatggtcttcctacca
ctgacctacgaccaccaggttgtagatggcgcagatgctggtcgcttcctgaccaccatc
aaggaccgccttgagaccgctaacttcgaaggcgatctgcagctctaa

DBGET integrated database retrieval system