KEGG   Corynebacterium glaucum: CGLAU_03210Help
Entry
CGLAU_03210       CDS       T05058                                 

Gene name
cfiA
Definition
(GenBank) 2-oxoglutarate carboxylase large subunit
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
cgv  Corynebacterium glaucum
Pathway
cgv00620  Pyruvate metabolism
cgv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cgv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CGLAU_03210 (cfiA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cgv02000]
    CGLAU_03210 (cfiA)
Enzymes [BR:cgv01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     CGLAU_03210 (cfiA)
Transporters [BR:cgv02000]
 Other transporters
  Primary active transporters [TC:3]
   CGLAU_03210 (cfiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like HGTP_anticodon
Motif
Other DBs
NCBI-ProteinID: AQQ14626
UniProt: A0A1Q2HUU9
Position
640213..641766
Genome map
AA seq 517 aa AA seqDB search
MALNPEELSTETLAEVLAAGGRPADSEREIKIVDTTFRDAHQSIWATRMRTEHILSLIDD
VTNAGFEHVDLVAPIEFDVPVRYIREDPWERVRLVHEAAPDTKFRAMVRSRNLASFDFLP
DDVIHTWVERLRANGFAVIGAFDGLNDIDNIADTLVLAKELGAETYGCLSYCLSPVHTDQ
LYIDKAKELLDRTDCDRIMLKDAPGLLTPDRMKTIIPAIRSVIGDRTLEVHTHSLTGLSP
LTYLFAAELGVDAIHTSIAPLANGQGQPATQALARDLRALGYTVNIDDERVDNASKRIQE
IADNEGKPVGVPRAYDGVHYMHQLPGGMLTNFESQLATAGLSDRFEDLLYETARVREELA
YPIMITPFAQFVGTQAVMNVISGERYSVVPNEIKKYALGYYGEPLAPIDPDVLEKIIANG
SSEIKEERPELQPALPALQEQYPDDDIDTILLRATISGNNVDEMKRYVAEGRSGQGEGIA
GGTLTALVKQIADIAETGQFRLKAEDLEINLTKGENK
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atggctctgaaccctgaggaactgagcacagaaaccctcgctgaagtactggctgccggc
ggtcgaccggcggatagcgagcgtgaaattaaaatcgtcgacaccacgtttcgtgacgcg
caccagtccatctgggcgactcgtatgcgcacggagcacattctttcgcttatcgacgat
gtgaccaacgccggattcgaacacgtcgacctcgtcgcgccgatcgagttcgatgtcccg
gtgcgctacatccgagaagatccgtgggagcgcgtgcgtctcgtccacgaggcggcaccg
gacacgaagttccgcgccatggttcgttcgcgcaacctcgcgtcgttcgacttcctgccg
gacgatgtcatccacacctgggtcgagcgcctgcgtgcgaacggcttcgccgtcatcggt
gcttttgatgggctcaacgacatcgacaacattgccgataccctggttttggccaaggag
ctcggcgctgagacctatggctgcttgtcctattgcctctcaccggtgcacaccgaccag
ctctacatcgacaaggccaaggagctgctggaccgcacggactgcgaccgcatcatgctc
aaggacgccccagggttgctcaccccggaccgcatgaagaccatcattcctgcgatccgt
tccgtgattggagacaggacgcttgaggtgcacacgcactcgctgaccggcctttctccg
ctgacgtacctgtttgctgcggagctgggtgtggatgcgatccacacctctatcgctccg
ttggcaaatggccagggtcagcccgccacccaggcgcttgcccgcgatctgcgtgcgttg
ggctacaccgtcaacatcgacgacgagcgcgtggacaacgcttccaagcgcatccaggag
attgcggacaacgaaggcaaaccggttggcgtgccgcgcgcctacgatggcgtgcactac
atgcaccagctgccgggcggcatgctcaccaacttcgagtcccagctcgcgaccgccggc
ctctcggaccgcttcgaggacctgctctacgaaactgcccgcgttcgcgaagagttggca
tacccgatcatgatcaccccgtttgcccagttcgtgggtacccaggctgtcatgaacgtg
atctccggcgagcgctactccgttgtgcctaacgagattaagaagtacgcgctcggatac
tacggtgaaccgcttgcaccgatcgacccggacgtgctggagaagatcatcgccaacggt
tcctccgagatcaaggaagagcgccccgagctgcagccggcactgccggcgctgcaggag
cagtacccagacgatgacatcgacacgatcctgctgcgcgcaaccatctcgggcaacaac
gtcgacgaaatgaagcgctacgtcgccgaggggcgctccggccagggtgagggcattgct
ggcggcaccctcaccgcgctggtcaagcagatcgcggacatcgccgagaccggacagttc
cgtctcaaagccgaagacctcgaaatcaacctcaccaaaggagaaaacaagtaa

DBGET integrated database retrieval system