KEGG   Corynebacterium glutamicum B253: SB89_03640Help
Entry
SB89_03640        CDS       T03668                                 

Definition
(GenBank) pyruvate carboxylase
  KO
K01958  pyruvate carboxylase [EC:6.4.1.1]
Organism
cgx  Corynebacterium glutamicum B253
Pathway
cgx00020  Citrate cycle (TCA cycle)
cgx00620  Pyruvate metabolism
cgx01100  Metabolic pathways
cgx01120  Microbial metabolism in diverse environments
cgx01200  Carbon metabolism
cgx01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cgx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SB89_03640
   00620 Pyruvate metabolism
    SB89_03640
Enzymes [BR:cgx01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     SB89_03640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 PYC_OADA Biotin_carb_N Biotin_carb_C HMGL-like Biotin_lipoyl Dala_Dala_lig_C ATP-grasp Biotin_lipoyl_2 ATP-grasp_3 GCV_H RnfC_N
Motif
Other DBs
NCBI-ProteinID: AJE66716
Position
767359..770781
Genome map
AA seq 1140 aa AA seqDB search
MSTNTSSTLPAFKKILVANRGEIAVRAFRAALETGAATVAIYPREDRGSFHRSFASEAVR
IGTEGSPVKAYLDIDEIIGAAKKVKADAIYPGYGFLSENAQLARECAENGITFIGPTPEV
LDLTGDKSRAVTAAKKAGLPVLAESTPSKNIDDIVKSAEGQTYPIFVKAVAGGGGRGMRF
VSSPDELRKLATEASREAEAAFGDGSVYVERAVINPQHIEVQILGDRTGEVVHLYERDCS
LQRRHQKVVEIAPAQHLDPELRDRICADAVKFCRSIGYQGAGTVEFLVDEKGNHVFIEMN
PRIQVEHTVTEEVTEVDLVKAQMRLAAGATLKELGLTQDKIKTHGAALQCRITTEDPNNG
FRPDTGTITAYRSPGGAGVRLDGAAQLGGEITAHFDSMLVKMTCRGSDFETAVARAQRAL
AEFTVSGVATNIGFLRALLREEDFTSKRIATGFIADHPHLLQAPPADDEQGRILDYLADV
TVNKPHGVRPKDVAAPIDKLPNIKDLPLPRGSRDRLKQLGPAAFARDLREQDALAVTDTT
FRDAHQSLLATRVRSFALKPAAEAVAKLTPELLSVEAWGGATYDVAMRFLFEDPWDRLDE
LREAMPNVNIQMLLRGRNTVGYTPYPDSVCRAFVKEAATSGVDIFRIFDALNDVSQMRPA
IDAVLETNTAVAEVAMAYSGDLSDPNEKLYTLDYYLKMAEEIVKSGAHILAIKDMAGLLR
PAAVTKLVTALRREFDLPVHVHTHDTAGGQLATYFAAAQAGADAVDGASAPLSGTTSQPS
LSAIVAAFAHTRRDTGLSLEAVSDLEPYWEAVRGLYLPFESGTPGPTGRVYRHEIPGGQL
SNLRAQATALGLADRFELIEDNYAAVNEMLGRPTKVTPSSKVVGDLALHLVGAGVDPADF
AADPQKYDIPDSVIAFLRGELGNPPGGWPEPLRTRALEGRSEGKAPLTEVPEEEQAHLDA
DDSKERRNSLNRLLFPKPTEEFLEHRRRFGNTSALDDREFFYGLVEGRETLIRLPDVRTP
LLVRLDAISEPDDKGMRNVVANVNGQIRPMRVRDRSVESVTATAEKADSSNKGHVAAPFA
GVVTVTVAEGDEVKAGDAVAIIEAMKMEATITASVDGKIDRVVVPAATKVEGGDLIVVVS
NT seq 3423 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgactaacacatcttcaacgcttccagcattcaaaaagatcttggtagcaaaccgc
ggcgaaatcgcggtccgtgctttccgtgcagcactcgaaaccggtgcagccacggtagct
atttacccccgtgaagatcggggatcattccaccgctcttttgcttctgaagctgtccgc
attggtactgaaggctcaccagtcaaggcgtacctggacatcgatgaaattatcggtgca
gctaaaaaagttaaagcagatgctatttacccgggatatggcttcctgtctgaaaatgcc
cagcttgcccgcgagtgcgcggaaaacggcattacttttattggcccaaccccagaggtt
cttgatctcaccggtgataagtctcgtgcggtaaccgccgcgaagaaggctggtctgcca
gttttggcggaatccaccccgagcaaaaacatcgatgacatcgttaaaagcgctgaaggc
cagacttaccccatctttgtaaaggcagttgccggtggtggcggacgcggtatgcgcttt
gtttcttcacctgatgagctccgcaaattggcaacagaagcatctcgtgaagctgaagcg
gcattcggcgacggttcggtatatgtcgaacgtgctgtgattaacccccagcacattgaa
gtgcagatccttggcgatcgcactggagaagttgtacacctttatgaacgtgactgctca
ctgcagcgtcgtcaccaaaaagttgtcgaaattgcgccagcacagcatttggatccagaa
ctgcgtgatcgcatttgtgcggatgcagtaaagttctgccgctccattggttaccagggc
gcgggaaccgtggaattcttggtcgatgaaaagggcaaccacgtcttcatcgaaatgaac
ccacgtatccaggttgagcacaccgtgactgaagaagtcaccgaggtggacctggtgaag
gcgcagatgcgcttggctgctggtgcaaccttgaaggaattgggtctgacccaagataag
atcaagacccacggtgcagcactgcagtgccgcatcaccacggaagatccaaacaacggc
ttccgcccagataccggaactatcaccgcgtaccgctcaccaggcggagctggcgttcgt
cttgacggtgcagctcagctcggtggcgaaatcaccgcacactttgactccatgctggtg
aaaatgacctgccgtggttccgactttgaaactgctgttgctcgtgcacagcgcgcgttg
gctgagttcaccgtgtctggtgttgcaaccaacattggtttcttgcgtgcgttgctgcgt
gaagaggacttcacttccaagcgcatcgccaccggattcattgccgatcacccgcacctc
cttcaggctccacctgctgatgatgagcagggacgcatcctggattacttggcagatgtc
accgtgaacaagcctcatggtgtgcgtccaaaggatgttgcagctcctatcgataagctg
cctaacatcaaggatctgccactgccacgtggttcccgtgaccgcctgaagcagcttggc
ccagctgcgtttgctcgtgatctccgtgagcaggacgcactggcagttactgatacgacc
ttccgcgatgcacaccagtctttgcttgcgacccgagtccgctcattcgcactgaagcct
gcggcagaggccgtcgcaaagctaactcctgagcttttgtccgtggaggcctggggcggc
gcgacctacgatgtggcgatgcgtttcctctttgaggatccgtgggacaggctcgacgag
ctgcgcgaggcgatgccgaatgtaaacattcagatgctgcttcgcggccgcaacaccgtg
ggatacaccccgtacccagactccgtctgccgcgcgtttgtcaaggaagctgccacctcc
ggcgtggacatcttccgcatcttcgacgcgcttaacgacgtctcccagatgcgtccagca
atcgacgcagtcctggagaccaacaccgcggtagccgaggtggctatggcttattctggt
gatctctctgatccaaatgaaaagctctacaccctggattactacctaaagatggcagag
gagatcgtcaagtctggcgctcacatcttggccattaaggatatggctggtctgcttcgc
ccagctgcggtaaccaagctggtcaccgcactgcgccgtgaattcgatctgccagtgcac
gtgcacacccacgacactgcgggtggccagttggctacctactttgctgcagctcaagct
ggtgcagatgctgttgacggtgcttccgcaccactgtctggcaccacctcccagccatcc
ctgtctgccattgttgctgcattcgcgcacacccgtcgcgataccggtttgagcctcgag
gctgtttctgacctcgagccatactgggaagcagtgcgcggactgtacctgccatttgag
tctggaaccccaggcccaaccggtcgcgtctaccgccacgaaatcccaggcggacagttg
tccaacctgcgtgcacaggccaccgcactgggccttgctgatcgcttcgagctcatcgaa
gacaactacgcagccgttaatgagatgctgggacgcccaaccaaggtaaccccatcctcc
aaggttgttggcgacctcgcactccacctcgttggtgcgggtgtggatccagcagacttt
gctgccgatccacaaaagtacgacatcccagactctgtcatcgcgttcctgcgcggcgag
cttggtaaccctccaggtggctggccagagccactgcgcacccgcgcactggaaggccgc
tccgaaggcaaggcacctctgacggaagttcctgaggaagagcaggcgcacctcgacgct
gatgattccaaggaacgtcgcaacagcctcaaccgcctgctgttcccgaagccaaccgaa
gagttcctcgagcaccgtcgccgcttcggcaacacctctgcgctggatgatcgtgaattc
ttctacggcctggtcgaaggccgcgagactttgatccgcctgccagatgtgcgcacccca
ctgcttgttcgcctggatgcgatctccgagccagacgataagggtatgcgcaatgttgtg
gccaacgtcaacggccagatccgcccaatgcgtgtgcgtgaccgctccgttgagtctgtc
accgcaaccgcagaaaaggcagattcctccaacaagggccatgttgctgcaccattcgct
ggtgttgtcactgtgactgttgctgaaggtgatgaggtcaaggctggagatgcagtcgca
atcatcgaggctatgaagatggaagcaacaatcactgcttctgttgacggcaaaatcgat
cgcgttgtggttcctgctgcaacgaaggtggaaggtggcgacttgatcgtcgtcgtttcc
taa

DBGET integrated database retrieval system