KEGG   Corynebacterium glutamicum B253: SB89_04715Help
Entry
SB89_04715        CDS       T03668                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
cgx  Corynebacterium glutamicum B253
Pathway
cgx00450  Selenocompound metabolism
cgx00970  Aminoacyl-tRNA biosynthesis
cgx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cgx00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    SB89_04715
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SB89_04715
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cgx01007]
    SB89_04715
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cgx03016]
    SB89_04715
Enzymes [BR:cgx01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     SB89_04715
Amino acid related enzymes [BR:cgx01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   SB89_04715
Transfer RNA biogenesis [BR:cgx03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    SB89_04715
 Prokaryotic type
   Other AARSs
    SB89_04715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f DZR
Motif
Other DBs
NCBI-ProteinID: AJE66916
Position
1010721..1012553
Genome map
AA seq 610 aa AA seqDB search
MTKNVLVSVAWPYANGPRHIGHVAGFGVPSDVFARFQRMSGNNVLMVSGTDEHGTPLLVQ
ADKEGVTVQDLADKYNRQIVEDLTGLGLSYDLFTRTTTSNHYAVVQELFRGLYDNGYMIK
ETTLGAISPSTGRTLPDRYIEGTCPICGTDGARGDQCDNCGNQLDPADLINPVSKINGET
PEFVETEHFLLDLPALAEALTEWLKGREDWRPNVLKFSLNLLDDIRPRAMSRDIDWGIPI
PVEGWQDNNAKKLYVWFDAVVGYLSASIEWAYRSGDPEAWRTFWNDPETKSYYFMGKDNI
TFHSQIWPAELLGYAGKGSRGGENGDLGVLNLPTEVVSSEFLTMSGSKFSSSKGVVIYVK
DFLKEFGPDALRYFIAVAGPENNDTDFTWDEFVRRVNNELANGWGNLVNRTVSMAHKNFG
EVPVPGALEESDKKILDLATAAFESVAANLDQSKFKAGISEIMHVVGEANAYIAEQEPWK
LAKDDTKRERLATVLWTALQVVSDCNTMLTPYLPHTAQKVHETLGRDGIWAATPQIVEVT
NESPRQPIGVGLPDPEHTYPVIMGDYKTQLAKWQRIDVVPGTTLEKPAPLIAKLDPELGE
TGPEWAPVQN
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atgacgaagaacgtgctcgtatctgttgcctggccgtatgccaacggaccccgtcacatt
ggacatgtggcggggtttggtgtcccctccgatgtgttcgcaaggttccagcgaatgtct
ggcaacaacgtgctcatggtgtccggcaccgatgagcacggcacgccacttctggttcaa
gcagacaaagaaggcgtcaccgttcaagacctcgcggataagtacaaccgccagatcgtc
gaagacctcaccggcctgggcctgtcctatgaccttttcacccgcaccaccacctccaac
cactacgcagtagtgcaggaactgttccgtggtctgtacgacaacggttacatgatcaag
gaaaccaccctcggtgcgatttccccatccactggccgtaccctgccagaccgctacatt
gaaggcacctgcccaatctgtggcaccgacggcgctcgtggcgaccagtgcgacaactgc
ggaaaccagctcgatccagcggacctgatcaacccggtgtccaagatcaacggcgaaacc
ccagagttcgttgagaccgaacacttcctgctcgacctgccagcactagctgaagcacta
accgagtggctgaagggacgcgaagactggcgtccaaacgtgttgaagttctcgctcaac
ctgctggacgatatccgcccacgcgcaatgtcgcgcgatatcgactggggcatcccaatc
ccagttgaaggatggcaagacaacaacgccaagaagctctacgtctggttcgacgctgtc
gtgggctacttgtccgcatccatcgaatgggcctaccgctccggcgacccagaagcatgg
cgcaccttctggaatgatccagaaaccaagtcctactacttcatgggcaaagacaacatc
accttccactcccagatctggccagctgaacttctcggctacgcaggtaagggctcccgc
ggtggagaaaacggtgacctgggtgttctgaacctgcctactgaggttgtttcctctgag
ttcctgactatgtctggatccaagttctcctcatccaagggcgttgtcatctacgtgaag
gacttcctcaaggagttcggcccagatgcgctgcgatacttcatcgctgtcgcaggccca
gaaaacaacgacaccgacttcacctgggatgaatttgtccgccgcgtaaacaacgaattg
gcaaacggctggggcaacctggtcaaccgcaccgtttctatggcgcacaagaactttggt
gaagtaccagtacctggcgcactggaagaatctgacaagaagatccttgatcttgctacc
gctgcctttgaatccgttgctgcgaacctggatcagtccaagttcaaggccggtatctct
gaaatcatgcacgttgtcggtgaggccaacgcctacatcgcagagcaagaaccatggaag
cttgccaaggatgacaccaagcgcgagcgtcttgccaccgtgctgtggactgcgctgcag
gttgtttctgactgcaacaccatgctgaccccatacctgccacacaccgcccaaaaggtg
catgagaccttgggccgtgatggaatctgggctgcaacaccacagatcgtggaagtcacc
aacgaatcaccacgccagccaatcggcgtggggctaccagatccagagcacacctaccca
gtaatcatgggcgactacaagacccagctggctaagtggcagcgcatcgacgtcgtgcca
ggcaccaccttggagaagccagcaccgctgatcgctaagctcgatccagaacttggcgaa
accggcccagaatgggcaccagtgcagaactaa

DBGET integrated database retrieval system