KEGG   Corynebacterium glutamicum B253: SB89_10265Help
Entry
SB89_10265        CDS       T03668                                 

Definition
(GenBank) acid phosphatase
  KO
K22316  ribonuclease H / adenosylcobalamin/alpha-ribazole phosphatase [EC:3.1.26.4 3.1.3.73]
Organism
cgx  Corynebacterium glutamicum B253
Pathway
cgx00860  Porphyrin and chlorophyll metabolism
cgx01100  Metabolic pathways
cgx03030  DNA replication
Brite
KEGG Orthology (KO) [BR:cgx00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SB89_10265
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    SB89_10265
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cgx03032]
    SB89_10265
Enzymes [BR:cgx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     SB89_10265
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.4  ribonuclease H
     SB89_10265
DNA replication proteins [BR:cgx03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    RNase H
     SB89_10265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 RVT_3 RNase_H
Motif
Other DBs
NCBI-ProteinID: AJE67903
Position
complement(2218167..2219312)
Genome map
AA seq 381 aa AA seqDB search
MKLVIEADGGSRGNPGVAGSGTVVYSDNKAEVLREIAYVVGTKATNNVAEYRGLLEGLKA
ARELGATSVEVFMDSKLVVEQMSGRWKIKHPDMKVLAIEAREIASGIESVSYNWIPREKN
KRADALSNVAMDAAAAGKPVGIVGDFDSDSSDSGADPVKEDLNCTETKPTNWNGATSDPT
RFLLLRHGQTAMSAARLYSGRSNPALSELGEKQAAAAARRLAQTGGIDAIVSSPLTRTLQ
TAEAAASALGIKVRVIDDLIETDFGLWDGKTFSEAHEQDPQLHTKWLSDSSVAPPGGESL
QAVNRRVKKARESLQHEYGAANVLVVSHVTPIKAIMRQALDAGPSFFQKAHLDLASLSIA
EFYEDGPTCVRLFNDTSHLEA
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
gtgaaattagtgatcgaggccgacggcggctcccgcggaaacccaggagtcgcaggttcc
ggcaccgtggtgtactccgacaacaaggcagaagtccttcgggaaattgcctatgtggtg
ggaactaaagcaactaacaatgttgccgaataccgtggcctgttagaaggacttaaagcc
gcccgtgaactcggtgccacctccgtggaagttttcatggactccaaactcgtcgtcgaa
caaatgtcaggccggtggaaaatcaaacaccccgacatgaaagttctagcgatcgaagct
cgtgagattgcctccggaattgagtcggtttcatataactggattccacgtgaaaaaaac
aaacgtgcagacgcgttgtccaacgtggcgatggatgcggcagcagctggaaaaccagtc
ggaatagtgggcgattttgattctgattcttcggattcgggcgctgacccggtaaaagaa
gacctcaactgtaccgaaaccaaacccaccaattggaacggcgcaacctcagaccccaca
cgtttcctgttgcttcgacacggccaaaccgccatgtctgcagcacgcctttactccggt
aggtccaacccagcgctgtctgaactcggtgaaaaacaagcagcagcggccgcacggcga
cttgcacaaaccggtggtatcgacgccatcgtgagttcgccacttactcgcacactgcaa
actgcagaagcagcagctagcgcattaggtataaaagtgcgcgtcattgatgacctcatc
gaaacagatttcggactgtgggacggaaaaacattttcagaagcccatgaacaagatcca
caactccacaccaaatggctcagtgactcatccgtcgcaccacccggtggcgagtccttg
caagcagtaaatcggcgtgtgaaaaaagcgcgggaaagcctccaacatgaatacggcgca
gccaatgttctagtagtcagccacgtcaccccaatcaaagccatcatgcggcaagccttg
gacgcaggcccatccttcttccaaaaggcacacctcgacttggcgtcgctgtccattgca
gagttctacgaagacggcccaacctgcgtgagactgttcaacgacacctcacatttagaa
gcctga

DBGET integrated database retrieval system