KEGG   Corynebacterium glutamicum B253: SB89_11110Help
Entry
SB89_11110        CDS       T03668                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cgx  Corynebacterium glutamicum B253
Pathway
cgx00071  Fatty acid degradation
cgx00072  Synthesis and degradation of ketone bodies
cgx00280  Valine, leucine and isoleucine degradation
cgx00310  Lysine degradation
cgx00362  Benzoate degradation
cgx00380  Tryptophan metabolism
cgx00620  Pyruvate metabolism
cgx00630  Glyoxylate and dicarboxylate metabolism
cgx00640  Propanoate metabolism
cgx00650  Butanoate metabolism
cgx00900  Terpenoid backbone biosynthesis
cgx01100  Metabolic pathways
cgx01110  Biosynthesis of secondary metabolites
cgx01120  Microbial metabolism in diverse environments
cgx01130  Biosynthesis of antibiotics
cgx01200  Carbon metabolism
cgx01212  Fatty acid metabolism
cgx02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cgx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SB89_11110
   00630 Glyoxylate and dicarboxylate metabolism
    SB89_11110
   00640 Propanoate metabolism
    SB89_11110
   00650 Butanoate metabolism
    SB89_11110
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SB89_11110
   00072 Synthesis and degradation of ketone bodies
    SB89_11110
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SB89_11110
   00310 Lysine degradation
    SB89_11110
   00380 Tryptophan metabolism
    SB89_11110
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SB89_11110
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SB89_11110
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SB89_11110
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cgx04147]
    SB89_11110
Enzymes [BR:cgx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SB89_11110
Exosome [BR:cgx04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SB89_11110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AJE68051
UniProt: A0A0U4XB51
Position
2396303..2397529
Genome map
AA seq 408 aa AA seqDB search
MNPQDIVICSPLRTPVGAYGGSFTGVPVEELATTVINAIVEATGITGDDVDDLILGQASP
NGAAPALGRVVALDSKLGQNVPGMQLDRRCGSGLQAIVTAAAHVASGAADLIIAGGAESM
SRVEYTVSGDIRWGVKGGDMQLRDRLAEARETAGGRNHPIPGGMIETAENLRREYGISRE
EQDKISAASQQRWGKAADAGLFDDEIVPVTVPAKKRGQEPTIVSRDEHGRPGTTVEKLAA
LRPIMGRQDAEATVTAGNASGQNDGAAAVIVTTRAKAEEKGLRPVMRLAGWSVAAVPPET
MGIGPVPATKKVLDRLGLTLEDIGAIELNEAFAAQALSVLKEWNISWEDERVNPLGSGIS
MGHPVGATGARMAVTLAHRMQRENTQYGLATMCIGGGQGLAAVFEKEN
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgaaccctcaagatattgtcatctgttccccattgcgcaccccagttggtgcttacggc
ggatctttcaccggcgtccctgttgaagaattggccaccaccgtgatcaacgcgatcgtt
gaggcaaccggcatcaccggcgacgatgtggacgatctgatcctcggccaggcatccccc
aacggtgcggctccagcactgggccgtgttgttgctctagattccaagcttggccaaaac
gttccaggcatgcagcttgatcgccgctgtggttccggcctgcaggcaatcgtcaccgct
gctgcacacgttgcatccggcgctgctgatctgatcatcgcaggtggtgcagaatccatg
agccgcgttgagtacaccgtgtccggcgatatccgttggggtgtcaagggcggcgacatg
cagcttcgtgaccgccttgcagaagcacgcgaaaccgctggcggacgcaaccacccgatc
cctggtggcatgatcgagaccgctgagaacctgcgtcgcgaatacggcatctcccgcgag
gagcaggacaagatctccgcagcgtcccagcagcgttggggcaaggctgctgatgcgggg
cttttcgacgacgagatcgtgccagtcaccgtccctgccaagaagcgcggccaggagcca
accatcgtttctcgtgacgagcatggtcgaccaggaacaaccgtcgaaaagcttgctgct
ttgcgccccatcatgggccgccaggatgcggaagcaaccgtcaccgctggcaacgcgtcc
ggccaaaatgatggcgctgctgccgtcatcgtgaccactcgcgccaaggccgaggagaag
ggcctgcgcccagtcatgcgtttggctggctggtctgtggctgctgttcccccagagacc
atgggtattggacctgttcctgccaccaagaaggtcctggatcgtttgggccttaccctg
gaggacatcggcgcgatcgaactcaacgaagctttcgcagctcaggcactgtctgtgctg
aaggaatggaacatttcttgggaagatgagcgcgtcaacccactgggttccggtatttcc
atgggacacccagtcggtgccaccggtgctcgcatggcagtaaccttggctcaccgcatg
cagcgtgaaaacactcagtacggactggccaccatgtgcatcggtggcggccaggggctt
gcagctgtctttgaaaaggagaactaa

DBGET integrated database retrieval system