KEGG   Corynebacterium glutamicum B253: SB89_12080Help
Entry
SB89_12080        CDS       T03668                                 

Definition
(GenBank) acetyl-CoA hydrolase
  KO
K18118  succinyl-CoA:acetate CoA-transferase [EC:2.8.3.18]
Organism
cgx  Corynebacterium glutamicum B253
Pathway
cgx00020  Citrate cycle (TCA cycle)
cgx00620  Pyruvate metabolism
cgx00650  Butanoate metabolism
cgx01100  Metabolic pathways
cgx01110  Biosynthesis of secondary metabolites
cgx01120  Microbial metabolism in diverse environments
cgx01130  Biosynthesis of antibiotics
cgx01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cgx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SB89_12080
   00620 Pyruvate metabolism
    SB89_12080
   00650 Butanoate metabolism
    SB89_12080
Enzymes [BR:cgx01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.18  succinyl-CoA:acetate CoA-transferase
     SB89_12080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetylCoA_hyd_C AcetylCoA_hydro CoA_trans Phage_rep_org_N
Motif
Other DBs
NCBI-ProteinID: AJE68198
Position
complement(2595538..2597046)
Genome map
AA seq 502 aa AA seqDB search
MSDRIASEKLRSKLMSADEAAQFVNHGDKVGFSGFTGAGYPKALPTAIANRAKEAHGAGN
DYAIDLFTGASTAPDCDGVLAEADAIRWRMPYASDPIMRNKINSGSMGYSDIHLSHSGQQ
VEEGFFGQLNVAVIEVTRITEDGHIIPSSSVGNNVEWLNAAEKVILEVNSWQSENLEGMH
DIWSVPALPNRIAVPINKAGDRIGKTYIEFDTDKVVAIVETNTPDRNAPFKPVDEVSQKI
AGNFLDFLEGEVAAGRLSYDGYVMQSGVGNVPNAVMAGLLESKFENIQAYTEVIQDGMVD
LIDAGKMTVASATSFSLSPEYAEKMNNEAKRYRESIILRPQQISNHPEVIRRVGLIATNG
LIEADIYGNVNSTNVSGSRVMNGIGGSGDFTRNGYISSFITPSEAKGGAISAIVPFASHI
DHTEHDVMVVISEYGYADLRGLAPRERVAKMIGLAHPDYRPLLEEYYARATSGDNKYMQT
PHDLATAFDFHINLAKNGSMKA
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgtctgatcgcattgcttcagaaaagctgcgctccaagctcatgtccgccgacgaggcg
gcacagtttgttaaccacggtgacaaggttggtttctccggcttcaccggcgctggctac
ccaaaggcactgcctacggcaatcgctaaccgggctaaagaagcacacggtgcaggcaac
gactacgcaatcgacctgttcactggcgcatccaccgcccctgactgcgatggcgtactt
gcagaagctgacgctatccgctggcgcatgccatacgcatctgatccaatcatgcgtaac
aagatcaactccggctccatgggatactccgatatccacctgtcccactccggccagcag
gttgaagagggcttcttcggccagctcaacgtagctgtcattgaagtcacccgcatcact
gaagacggacacatcatcccttcttcctccgtgggtaacaacgttgagtggctcaacgct
gcagagaaggtcatcctcgaggttaactcttggcagtccgagaacctcgagggcatgcac
gacatctggtctgtaccagcactgccaaaccgcatcgctgtgccaatcaacaaggccggc
gaccgcatcggtaagacctacatcgaattcgacaccgacaaggttgtcgcaattgttgaa
accaacaccccagaccgcaacgcaccatttaagcctgtcgacgaggtctctcagaagatc
gccggtaacttcctcgacttcctcgaaggtgaagttgcagctggccgtctttcctacgat
ggttacgtcatgcagtccggcgtgggcaacgtgcctaatgctgtgatggcaggcctgctg
gagtccaagtttgagaacatccaggcttacaccgaggttatccaggacggcatggttgac
cttatcgacgccggcaagatgaccgttgcttctgcaacctccttctccttgtctcctgag
tacgcagagaagatgaacaacgaggctaagcgctaccgtgagtccatcatcctgcgccca
cagcagatctctaaccacccagaggtgatccgtcgcgtcggcctgatcgcaactaacggt
cttatcgaagctgacatctatggcaacgttaactccaccaacgtttctggctcccgcgtc
atgaacggcatcggcggctccggcgacttcacccgtaacggctacatctccagcttcatc
accccttcagaggcaaagggcggcgcaatctctgcgatcgttcctttcgcatcccacatc
gaccacaccgagcacgatgtcatggttgttatctctgagtacggttacgcagaccttcgt
ggcctggctccacgtgagcgcgttgccaagatgatcggcctggcacaccctgattaccgc
ccactgctcgaggagtactacgctcgcgcaacctccggtgacaacaagtacatgcagacc
cctcatgatcttgcaaccgcgtttgatttccacatcaacctggctaagaacggctccatg
aaggcataa

DBGET integrated database retrieval system