KEGG   Corynebacterium glutamicum B253: SB89_12465Help
Entry
SB89_12465        CDS       T03668                                 

Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
cgx  Corynebacterium glutamicum B253
Pathway
cgx00520  Amino sugar and nucleotide sugar metabolism
cgx01100  Metabolic pathways
cgx01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cgx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SB89_12465
Enzymes [BR:cgx01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     SB89_12465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 DUF371 DHH
Motif
Other DBs
NCBI-ProteinID: AJE68268
Position
complement(2684233..2685399)
Genome map
AA seq 388 aa AA seqDB search
MAEVVHYQENAGQAVKKIEGRIVAPHGVIDGFLQLENGIITELSGEPAPKNAGFHPELPT
IVPGFIDLHNHGGNGGAFPTGTQDQARNAAQYHREHGTTVMLASMVSAPADALAAQVENL
IPLCEEGLLCGIHLEGPFINACRCGAQNPDFIFPGNPTDLARVIHAGKGWIKSITVAPET
DNLSELLDLCAAHHIIASFGHTDADFDTTTSAIALAKEKNVTVTATHLFNAMPPLHHRAP
GSVGALLAAARAGDAYVELIADGVHLADGTVDLARSNNAFFITDAMEAAGMPDGEYILGV
LNVTVTDGVARLRDGGAIAGGTSTLASQFVHHVRRGMTLIDATLHTSTVAAKILGLGDHE
IAKSNPANFVVFDSHGQMQKVHLGHQVL
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagtggtgcattatcaagaaaatgcaggtcaagcagttaaaaaaattgaggga
agaattgttgccccccacggggtgattgatggctttctccaactcgaaaacggcatcatc
acggaactctctggagaaccagcacctaaaaacgcaggattccaccccgaactccccacg
attgttcccggttttattgatcttcataatcacggtggaaacggtggcgcgtttcctacg
ggaacgcaggaccaggcgaggaacgccgcgcagtatcaccgcgaacatggcacgaccgtg
atgttggcaagcatggtttcggcgccggctgacgcactggcagcgcaggtggaaaacctt
attcccttgtgtgaagagggcctgctgtgcggcattcacctcgagggccctttcatcaac
gcatgccgttgtggtgctcaaaacccggatttcatttttcccggcaacccaacagatctt
gcccgggtgatccatgcgggaaaaggttggatcaaatcgatcacagtagcgccggaaact
gacaatctttctgagcttctcgatctctgcgcagcgcaccacatcattgcttccttcggg
cacactgatgcagattttgataccactaccagcgcaattgccttggctaaagagaaaaat
gtgacggtcacggctacgcatttgttcaatgcgatgcctccgctgcatcatagggctccc
ggcagcgtgggcgctttgcttgctgcggcacgtgccggggacgcatatgttgagttgatc
gccgacggcgtgcatttggccgatggaacggtcgatctagctcgttccaacaacgccttt
ttcatcacggacgccatggaagccgccggaatgccagacggtgagtacattttgggcgtt
ttgaacgtcaccgtcaccgatggagtcgcccgtctgcgcgatggcggcgccatcgccggg
ggcaccagcacactagcgagtcagttcgtgcaccacgtgcgcaggggtatgacgcttatc
gacgcgaccctccacacctcaaccgtcgccgctaaaattctcggtcttggcgatcacgaa
atcgctaaatccaaccctgcaaattttgtggtctttgactcacatggccagatgcaaaag
gtccatttaggtcatcaagtactttaa

DBGET integrated database retrieval system