KEGG   Corynebacterium glyciniphilum: CGLY_08360Help
Entry
CGLY_08360        CDS       T03073                                 

Gene name
coaBC
Definition
(GenBank) Coenzyme A biosynthesis bifunctional protein CoaBC
  KO
K13038  phosphopantothenoylcysteine decarboxylase / phosphopantothenate---cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
cgy  Corynebacterium glyciniphilum
Pathway
cgy00770  Pantothenate and CoA biosynthesis
cgy01100  Metabolic pathways
Module
cgy_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:cgy00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    CGLY_08360 (coaBC)
Enzymes [BR:cgy01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     CGLY_08360 (coaBC)
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase (CTP)
     CGLY_08360 (coaBC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DFP Flavoprotein NAD_binding_10
Motif
Other DBs
NCBI-ProteinID: AHW64117
UniProt: X5DTW3
Position
1787377..1788696
Genome map
AA seq 439 aa AA seqDB search
MTGLIRSRSPVGRGGGLGWFSVNENNLNVLVGVGGGIAAYKSGALVRYFTEAGHDVHVIP
TESALRFVGAATFEALSGNPVSTTVFEGVDEVRHVRLGQDADLIVIAPATADLLARLAHG
RADDLLTASVLVATCPVVLAPAMHTEMWQNPATRENVATLRRRGITVLEPAHGRLTGTDS
GAGRLPEPEHIGALATAALDRFGVFRPSLAGRRILITAGGTHEALDPVRYLGNASSGRQG
FALADVAVQRGAQVELVAGVTDDLPVPSGARVTRIRSARELEAAVEELAGGVDAVIMAAA
VADFRPASEAGAKLKKGGEDDLSTLALAENPDILQGLVERRRAGGLPEEVVIAGFAAETG
DEHHTPLDHARAKLERKGCDLLMCNAVGDGVVFGQNDSQGWILTPGDRPGAEEVTEVPAS
SKLVVASYIVDAIEELLPG
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
gtgacgggtctcatccgttcccggtccccggtgggccggggcggtgggctaggctggttc
tccgtgaatgaaaacaatctgaacgtgctcgtgggcgtgggtggcgggatcgccgcctac
aagtccggcgcactggtgcgctacttcaccgaggccgggcacgacgtgcatgtcatcccg
accgagtcggcgctgcgcttcgtcggcgccgccacgttcgaggctctgtcgggcaatccg
gtgtccaccacggtctttgagggcgtcgacgaggtccgccacgtccgcctcggccaggac
gctgacctgatcgtcatcgccccggcgaccgccgacctgctcgcccgtctggcccacggc
cgggcggacgacctgttgaccgccagtgtcctggtggccacctgcccggtggtgctggcc
ccggcgatgcacacggagatgtggcagaaccctgccacgcgggagaatgtcgccaccttg
cggcgtcgcgggatcacggtgctcgagcccgcccacggccggttgaccggtacggactcc
ggtgccggacgtctgccggaaccggaacacatcggcgcactggcgacggcggcgctggac
cggttcggtgtgttccggccgtcgctggcgggacgcaggattctgatcaccgccggtggc
acgcatgaggccctcgacccggtgcgttacctgggtaatgcgtcctcgggacgccaggga
ttcgccctggccgatgtcgccgtgcagcgcggtgcgcaggtggagctggtcgccggggtc
accgatgatcttccggtgccctcgggggcccgggtcacccgcatcaggagcgcccgcgag
ctggaggccgccgtcgaggagcttgccggtggggtggatgcggtgatcatggcggccgcg
gtggcggacttccgtccggccagtgaggccggcgcgaagctgaagaagggtggggaggac
gatctgtccacccttgcgttggcggagaacccggacatcctgcaggggctggtagagcgg
cgccgtgccggtggcctgccggaagaggtggtgatcgccggattcgccgcggagaccggc
gacgagcatcacacccccctggaccatgcccgtgcgaagctggagcgcaagggctgtgac
ttgttgatgtgcaatgccgtcggcgacggggtggtgttcggccagaacgacagccagggc
tggatcctcacccccggcgatcgtccgggcgccgaggaggtcaccgaggtcccggcgtcc
tcgaaactcgtggtcgcctcctacattgtcgacgcgatcgaggagctgttgcccggctga

DBGET integrated database retrieval system