KEGG   Corynebacterium glyciniphilum: CGLY_11105Help
Entry
CGLY_11105        CDS       T03073                                 

Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cgy  Corynebacterium glyciniphilum
Pathway
cgy00071  Fatty acid degradation
cgy00072  Synthesis and degradation of ketone bodies
cgy00280  Valine, leucine and isoleucine degradation
cgy00310  Lysine degradation
cgy00362  Benzoate degradation
cgy00380  Tryptophan metabolism
cgy00620  Pyruvate metabolism
cgy00630  Glyoxylate and dicarboxylate metabolism
cgy00640  Propanoate metabolism
cgy00650  Butanoate metabolism
cgy00900  Terpenoid backbone biosynthesis
cgy01100  Metabolic pathways
cgy01110  Biosynthesis of secondary metabolites
cgy01120  Microbial metabolism in diverse environments
cgy01130  Biosynthesis of antibiotics
cgy01200  Carbon metabolism
cgy01212  Fatty acid metabolism
cgy02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cgy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CGLY_11105
   00630 Glyoxylate and dicarboxylate metabolism
    CGLY_11105
   00640 Propanoate metabolism
    CGLY_11105
   00650 Butanoate metabolism
    CGLY_11105
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CGLY_11105
   00072 Synthesis and degradation of ketone bodies
    CGLY_11105
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CGLY_11105
   00310 Lysine degradation
    CGLY_11105
   00380 Tryptophan metabolism
    CGLY_11105
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CGLY_11105
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CGLY_11105
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CGLY_11105
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cgy04147]
    CGLY_11105
Enzymes [BR:cgy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CGLY_11105
Exosome [BR:cgy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CGLY_11105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AHW64666
UniProt: X5EDH3
Position
complement(2391635..2393242)
Genome map
AA seq 535 aa AA seqDB search
MTDALDPRTPVLVGVGQAADPVTADDYHRWSAADLAGEASRRAVQDAGLDPTVAAAIDTI
AVIRQFEISTPGAVAPLGKSDNIARSIAARIGADPRRAVLEVVGGQGPQHLVTEFSGAIA
DRDAEVVLLAGSEAISTARALAGRDDAPDFTENVGGQLEDRGMQVDDLHVPYEVRHGLLG
APPEYAVFENARRRRLGMNREDYATAMGELFAPFTQVAASNPYAAAPTERTAEELATVTE
RNRLIADPYPRFMVARDQVNQGAAVLLTSVGKARELGIPQDRWVFLHGYSDLTERTVTER
ADLSVSPASVLSATTAIERAGIIADDLAFLDLYSCFPIPVFNICDALGIAPDDPRGLTLT
GGLPFFGGAGNNYSMHAIAEMVDRLRRNPGTFGFVGANGGWMTKYSSGVYSTTPVEFTDW
DDRPLQEALDAVPAPDIVEHYSGPATLESYTVTTDLNRDWIGIVVARTPDNARVLAVSEA
RSPGGPGDAASDEVIELLSSDAVFGATLEIGQDGERNIIRGIVRDTTGTTEEAQA
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgacagacgcacttgacccccgtacccccgtcctcgtgggtgtcggacaggccgctgat
ccggtcaccgccgacgactatcaccgctggtcggctgctgatctcgccggggaagcgtcc
cgcagggcggtgcaggatgctggcctcgacccgaccgtcgccgccgccatcgacaccatt
gccgtcatccggcagttcgagatctccacgcccggggcggtcgcaccgctggggaagtcg
gacaatatcgctcgctccatcgccgcacggatcggcgcggacccacggcgtgccgtcctc
gaggtcgtcggtgggcaggggccgcagcatctcgtcaccgagttcagcggggccatcgcc
gacagggacgccgaggtggtgcttctggccggctccgaggcgatttccaccgcgcgtgcg
ttggcaggacgcgacgatgcccccgatttcaccgagaatgtcggcgggcagctggaggac
cggggtatgcaggtcgatgacctccacgtgccctacgaggtccggcacggacttctcggc
gctccgccggagtacgccgtcttcgagaatgcccggcgccggcgtctcgggatgaaccgc
gaggactacgcgacggcgatgggagagttgttcgcacccttcacccaggtcgcggcgtcc
aacccgtacgccgccgccccgacggagcggacggcggaggagctcgcgaccgtcaccgag
cgcaaccgtctcatcgccgacccctacccgcggttcatggtcgcccgtgaccaggtcaac
cagggtgcggcggtcctgctgacctcggtcggaaaagcacgggagctcgggatcccgcag
gacaggtgggtcttcctgcacggctacagcgacctgaccgaacgcaccgtgaccgaacgc
gcggacctgtcagtgtccccggcatcggtgctgtcggcgactacggcgatcgagcgcgcc
gggatcatcgccgatgatctggcgttcctggacctgtacagctgcttcccgatcccggtg
ttcaacatctgcgatgccctggggattgcgccggacgacccgcggggcctcaccctcacc
ggcgggctgccgttcttcggcggggcgggcaacaactactcgatgcatgccatcgccgag
atggtcgaccggctgcggaggaatccggggaccttcgggttcgtcggcgccaacggcggg
tggatgacgaagtactcctccggggtgtactccaccacgccagtggagttcaccgactgg
gacgaccggccgctgcaggaggcactggatgccgtacccgcccctgacatcgtggagcat
tactccggcccggcgacgctcgagtcctacacggtcaccaccgacctgaaccgggactgg
atcggcatcgtcgtggcccgcaccccggacaatgcccgggtcctcgcggtcagcgaggcc
cgaagccccggaggtcccggcgacgcagcatccgacgaggtcatcgaactgctgagttcg
gacgcggtcttcggcgcgacgctggagatcgggcaggacggcgagcgcaacatcatccgc
ggcatcgtacgcgacacgaccggcaccacagaggaggcacaggcatga

DBGET integrated database retrieval system