KEGG   Corynebacterium glyciniphilum: CGLY_13170Help
Entry
CGLY_13170        CDS       T03073                                 

Gene name
pyc1
Definition
(GenBank) Pyruvate carboxylase
  KO
K01958  pyruvate carboxylase [EC:6.4.1.1]
Organism
cgy  Corynebacterium glyciniphilum
Pathway
cgy00020  Citrate cycle (TCA cycle)
cgy00620  Pyruvate metabolism
cgy01100  Metabolic pathways
cgy01120  Microbial metabolism in diverse environments
cgy01200  Carbon metabolism
cgy01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cgy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CGLY_13170 (pyc1)
   00620 Pyruvate metabolism
    CGLY_13170 (pyc1)
Enzymes [BR:cgy01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     CGLY_13170 (pyc1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 PYC_OADA Biotin_carb_N Biotin_carb_C HMGL-like Biotin_lipoyl Dala_Dala_lig_C ATP-grasp ATP-grasp_3 Biotin_lipoyl_2 GCV_H PTS_EIIA_1
Motif
Other DBs
NCBI-ProteinID: AHW65074
UniProt: X5DUV2
Position
2850542..2854027
Genome map
AA seq 1161 aa AA seqDB search
MADPANHTGTTTPAGTTTPPAFSKILVANRGEIAVRAFRAAYETGASTVAVYPREDRNSF
HRSFADEAVRIGTEGSPVKAYLNIDEIIRAAKQTGADAVYPGYGFLSENAELARRCAENG
ITFIGPSPETLDLTGDKSAAVEAARRAGLPILDDSAPSEDIDELVSFAEGRTYPLFVKAV
AGGGGRGMRFVGSPDELAEKAAEASREAAAAFGDGRVYIERAVINPQHIEVQILGDTQGD
IIHLFERDCSLQRRHQKVVEIAPAQHISEELRDRICADAVTFCKSINYYGAGTVEFLVDE
NENHVFIEMNPRIQVEHTVTEEVTSIDLVKSQMNILAGASLEDLGLSQDSVQLRGAALQT
RITTEDPNNGFRPDTGTITAYRSPGGAGVRLDGAASLGGEITAHFDSMLVKMTCRGADFA
QAVTRAQRALNEFTVSGVATNIGFLRALLREDDFQNKRISTSFIADHPWLLQAPPADDEP
GRLLDYLADVTVNRPNSGRPTDIVPRRKLPAVVAQRDAKSAGEGVMAPPVPLGTRDRLLE
VGPAEFARQLRAQKPLAVTDTTFRDAHQSLLATRVRTTSLVSAAEAVARLTPELLSVEAW
GGATYDVALQFLHEDPWERLDQLREAMPNTNIQMLLRGRNTVGYTPYPDVVCRSFVTEAA
KSGVDIFRIFDALNDIDQMRTAVDAVLETGTGVAEVAMAYAGDLSNPAEDLYTLDYYLHL
AEQIVESGAHVLAIKDMAGLLRPQAASTLVSALRSNFDLPVHVHTHDTAGGQLATYLAAA
DAGADAVDGAAASMAGTTSQPSLSAIVAAFAHTDRDTGISLDAVNSLEPYWEAVRSLYSP
FESGLAGPTGRVYTHEIPGGQLSNLRTQATALGLGDRFELIEDAYAGVNKLLGRPTKVTP
SSKVVGDLALHLVGAGVTVEEFAADPQKYDIPASVIAFLRGELGTPPGGWPEPLRTKALE
GRASTASRVTEVPAEEEDHLNGDSSEERRASLSRLLFPKESEGFAEHKRNFGDVSILSDR
QFFYGLEEGEETVVRIKGNPPMVVRLDAVGEPDEKGMRQVVMNVNGQIRPMRVRDRSVES
VTAAAEKADPSLAGHVAAPFAGAVTVTAKVGDTVAAGDAVAVIEAMKMEASITAPVAGRI
ARVVMSQPTKVEGGDLLAVVE
NT seq 3486 nt NT seq  +upstreamnt  +downstreamnt
atggctgaccctgcgaaccacaccggcaccaccacacccgccggcaccacgacaccaccc
gcgttctccaagatcctcgtcgccaaccgcggcgaaatcgcggtgcgtgccttccgcgcc
gcctacgaaaccggggcatccaccgtcgcggtctacccccgcgaagaccgcaactccttc
caccgctccttcgccgatgaggcggtacgcatcggcaccgagggttcgcccgtcaaggca
tacctcaacatcgacgagatcatccgcgccgcaaagcagaccggggctgacgccgtctac
cccggttacggcttcctctcggagaatgcggaactcgcccgcaggtgcgccgagaacggc
atcaccttcatcggcccatccccggagaccctggacctcaccggcgacaagtccgccgcg
gtcgaggcggcccgccgggccggactcccgatcctcgacgattcagcccctagcgaggac
atcgacgagctcgtctccttcgcagaaggacgcacctacccgctgttcgtcaaggctgtc
gcgggtggcggaggacgcggcatgcgcttcgtcggttcccccgacgaactggcagagaag
gccgccgaggcgtcccgtgaggccgccgcggctttcggtgacggtcgtgtctacatcgaa
cgtgcggtgatcaacccgcagcacatcgaggtgcagatcctcggcgacacccagggcgac
atcatccacctcttcgagcgtgactgttcccttcaacgtcgtcaccagaaggtcgtggag
atcgccccggcccagcacatctccgaggaactgcgcgaccggatctgcgcggacgcggtg
acgttctgcaagtcgatcaactactacggtgccggcaccgtggagttcctcgtcgacgag
aacgagaaccacgtcttcatcgagatgaacccgcgcatccaggtcgagcacacggtgacc
gaggaggtcacctccatcgacctggtgaagtcgcagatgaacatcctcgcgggcgcgtcc
ctcgaggatctgggcctgagccaggacagcgtccagctgcgtggcgccgccctgcagacc
cgtatcaccaccgaggacccgaacaacggtttccgcccggacaccggcaccatcaccgcg
taccgctccccgggtggagcgggtgtgcgcctcgacggcgccgcgtccctcggtggcgag
atcaccgctcacttcgactcgatgctggtgaagatgacctgccgtggtgcggacttcgcc
caggcggtcacccgtgcccagcgcgccctcaacgagttcaccgtctccggtgtcgccacc
aacatcggtttcctgcgagcgctgctgcgtgaggacgacttccagaacaagcgcatctcc
acctccttcatcgccgaccacccgtggctgctgcaggccccgccggccgatgatgagccg
ggccgactgctcgactacctggccgacgtgaccgtcaaccggcccaacagcgggcgcccg
acggacatcgtcccgcgccgtaagctgccggccgtcgtcgcccagcgcgacgcgaagtcc
gctggcgagggcgtcatggcgccgccggtgccgctcggcacccgcgaccggctcctcgaa
gttggtccggcggagttcgcccggcagctgcgcgcacagaagcccctggctgtcacggac
accaccttccgtgacgcccaccagtccctgctcgccacccgcgtgcgcaccacctccctg
gtctccgcggcggaggccgtcgcccggctcaccccggagctgctctccgtcgaggcctgg
ggcggtgcaacctacgacgtcgcactgcagttcctccacgaggacccgtgggagcggctg
gaccagctacgcgaggcgatgccgaacaccaacatccagatgctgttgcgcggccgcaac
accgtcgggtacaccccgtacccggacgtggtctgcaggtccttcgtcaccgaggccgcg
aagagtggtgtggacatcttccgcatcttcgacgccctcaacgacatcgaccagatgcgc
accgccgtcgacgcggtcctggagacgggcacgggtgtcgccgaggttgcgatggcctac
gctggtgacctctcgaaccctgccgaagacctctacaccctcgactactacctgcatctg
gccgagcagatcgtcgagtccggcgcccacgtcctggcaatcaaggacatggccggactg
ctccgcccgcaggctgcgtccaccctcgtgtccgcactccggtccaacttcgacctgccc
gtgcacgtacacacccacgacaccgccggcggccagctcgccacctacctcgccgcggcg
gacgccggcgcggatgcggtggacggtgctgccgcgtcgatggcagggaccacctcccag
ccgtcgctgtccgcgatcgtcgccgccttcgcccacaccgaccgggacaccggcatctcg
ctggacgcggtgaactccctggagccgtactgggaggccgtccgctccctctacagcccg
ttcgagtccggcctcgccggtccgacgggccgggtctacacccacgagatccccggtggt
cagctgtccaacctgcggacccaggccaccgctctcggcctcggagaccgtttcgagctc
atcgaggacgcctacgccggtgtcaacaagctgctcggtcgtccgaccaaggtcaccccg
tcctccaaggtcgtcggcgatctcgcgctacacctcgtcggtgccggtgtgacggtcgag
gagttcgccgcagacccgcagaagtacgacatccctgccagtgtgatcgccttcctgcgc
ggtgagttgggcacgccgcccggtggctggccggagccgctgcgtacgaaggccctagag
ggccgcgcatccaccgcctcccgtgtcaccgaggtcccggctgaggaggaggatcacctg
aacggtgactcctccgaggagcgccgggcctcgctgagccgcctgctgttcccgaaggag
tcggagggcttcgccgagcacaagcgcaacttcggtgacgtgtcgatcctgtcggaccgg
cagttcttctacggcctcgaggagggtgaggagacggtggtgcggatcaagggcaaccct
ccgatggtggtccgcctggatgccgtcggtgaacccgacgagaagggcatgcgccaggtc
gtgatgaacgtcaacggccagatccgcccgatgcgggtgcgggaccggtcggtggagtcg
gtcaccgcagccgccgagaaggcagacccgtccctggccggtcacgtcgccgcaccattc
gccggggccgtcacggtcaccgccaaggtgggtgacacggtcgctgccggtgatgcggtg
gcggtgatcgaggcgatgaagatggaggcgtcaatcaccgccccggtcgccggcaggatc
gcccgggtggtgatgagccaaccaacgaaggttgaaggcggcgacctcctcgccgtcgtg
gagtaa

DBGET integrated database retrieval system