KEGG   Campylobacter hominis: CHAB381_0009Help
Entry
CHAB381_0009      CDS       T00577                                 

Definition
(GenBank) Ham1 family
  KO
K02428  XTP/dITP diphosphohydrolase [EC:3.6.1.66]
Organism
cha  Campylobacter hominis
Pathway
cha00230  Purine metabolism
Brite
KEGG Orthology (KO) [BR:cha00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    CHAB381_0009
Enzymes [BR:cha01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.66  XTP/dITP diphosphatase
     CHAB381_0009
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ham1p_like Plasmo_rep
Motif
Other DBs
NCBI-ProteinID: ABS52222
UniProt: A7HZE0
Position
complement(8610..9230)
Genome map
AA seq 206 aa AA seqDB search
MKIILATSNKDKVKEIKAFYKNYEIYALNEIMQPFEIKETGSSFKENALIKVNAVYKKLE
EMKLENEFMALSDDSGICVDILGGAPGIYSARYSNDMVIHPTDESNRAKLISKLHKKNVK
TSPAHYTACIALSCKSGNFTTHGFMHGRVIDEERGNNGFGYDFMFIANGFSKTIGELDEN
TKLKISHRSKGLFLMSKILKILNRSF
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaatcattcttgctacaagtaataaagataaagtaaaagagataaaagcattttat
aaaaattatgaaatttatgcacttaacgaaattatgcaaccttttgaaataaaagaaacg
ggctcgagttttaaagaaaacgcgcttataaaagtaaatgcggtttataaaaaactagaa
gaaatgaaacttgaaaatgaatttatggctcttagcgatgatagcggcatttgcgtggat
attttaggcggcgctcctggaatttattcggctcgttacagtaatgatatggttattcat
ccgacagatgaaagcaaccgcgcaaaactgatttccaaacttcataaaaaaaatgtaaaa
acttcgcctgcacattatacggcctgtattgcgctatcttgcaaatcaggaaattttacg
acacacggatttatgcacggaagagtgattgatgaagaacgtggaaataacggcttcgga
tatgattttatgtttatagcgaacggtttttcaaaaacaatcggcgaacttgatgaaaat
acaaaacttaaaatatctcaccgatcaaaagggctttttctgatgagcaaaattctaaaa
attttaaatagaagtttttga

DBGET integrated database retrieval system