KEGG   Campylobacter hominis: CHAB381_0572Help
Entry
CHAB381_0572      CDS       T00577                                 

Definition
(GenBank) D-alanine--D-alanine ligase (D-alanylalanine synthetase)(D-Ala-D-Ala ligase)
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
cha  Campylobacter hominis
Pathway
cha00473  D-Alanine metabolism
cha00550  Peptidoglycan biosynthesis
cha01100  Metabolic pathways
cha01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cha00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CHAB381_0572
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CHAB381_0572
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    CHAB381_0572
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cha01011]
    CHAB381_0572
Enzymes [BR:cha01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     CHAB381_0572
Peptidoglycan biosynthesis and degradation proteins [BR:cha01011]
 Precursor biosynthesis
  Amino acid ligase
   CHAB381_0572
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 ATP-grasp CPSase_L_D2 ATPgrasp_TupA ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: ABS51230
UniProt: A7I0W9
Position
complement(522022..523050)
Genome map
AA seq 342 aa AA seqDB search
MKFGIIFGGQSYEHEISIVSAISLKKVIKKECAYVFCDQDRNFYLIEPKNMIANYFSSGE
YKKAKELTIASNGFYVNGMFSKTRVEADVFVNVIHGCDGEDGKLASLLEFFNIPFIGPRL
EASVISYDKELTKNLAKAAGIKTIEYQIIKSSTLPSIPYPLIVKPSHLGSSIGIKIVKNH
NELSYAIDTAFELDSSAIIEPYIEDVKEYNLAGCKIDGEIEFSIIEEPQKDKFLDYFQKY
MDFSRSGKPQEANLGLSVKDNMKEAFRRVYNYGEFDGAIIRCDFFVINNEVYLNEINPNP
GSLANYLFNDFNDVLNRLAMNLPSNKHIQVGYELINAIVKNK
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttggaattattttcggtggtcaaagttatgaacatgaaatcagtatagtttcc
gcaatttcgcttaaaaaagtaataaaaaaagaatgcgcttatgttttttgcgatcaggat
cgcaacttttatttgatagaaccgaaaaatatgattgcaaactatttcagcagtggtgaa
tataaaaaagcaaaagagcttacaatagcaagcaatggattttacgtaaacggaatgttt
tcaaaaacacgcgtagaagctgatgtatttgtaaatgtaatccacggatgcgatggagaa
gacggtaaattagcctcacttctggaatttttcaatattccttttataggaccaagactg
gaagcaagcgtaataagctatgataaagagcttaccaaaaacttagctaaagccgccggt
attaaaactatagaatatcaaattattaaaagttcaactcttcctagcattccatatcct
ctaatcgtaaaaccatctcacctaggaagcagtataggcataaaaatagttaaaaatcac
aatgaattaagttacgctatcgatacggcttttgaacttgacagtagcgccattatagaa
ccatatatagaagatgtaaaagaatacaatcttgccggttgcaaaatagacggagagata
gaattttctatcattgaagaaccgcaaaaagataaatttctggattattttcaaaaatat
atggatttttcacgctcaggaaaacctcaagaagcaaatctgggcttatccgtaaaagat
aatatgaaagaggcgtttagacgagtttataactacggtgaatttgacggcgcgattatt
cgttgcgacttttttgttataaataatgaagtttatctaaatgaaatcaatccgaatcct
ggaagtttggcaaactatttatttaatgattttaacgatgtacttaatagactggctatg
aatttaccgtcaaataaacacattcaagtaggatatgaattaataaatgctatagtgaaa
aataaataa

DBGET integrated database retrieval system