KEGG   Campylobacter hominis: CHAB381_0584Help
Entry
CHAB381_0584      CDS       T00577                                 

Definition
(GenBank) 7-alpha-hydroxysteroid dehydrogenase
  KO
K00076  7-alpha-hydroxysteroid dehydrogenase [EC:1.1.1.159]
Organism
cha  Campylobacter hominis
Pathway
cha00121  Secondary bile acid biosynthesis
Brite
KEGG Orthology (KO) [BR:cha00001]
 09100 Metabolism
  09103 Lipid metabolism
   00121 Secondary bile acid biosynthesis
    CHAB381_0584
Enzymes [BR:cha01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.159  7alpha-hydroxysteroid dehydrogenase
     CHAB381_0584
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase
Motif
Other DBs
NCBI-ProteinID: ABS51028
UniProt: A7I0Y1
Position
534911..535696
Genome map
AA seq 261 aa AA seqDB search
MEMNNEFNGKTLVISGGTRGIGRAIVEEFAQNGVNIAFTYNSNEELAKKQCEELESEFGI
KARCYALNILEPATYKDLFLEIDNDFDRIDFFISNAIISGRAVAGGYTKFMRLKPRGLNN
IFTATVDAFIVGAQEAAKRMEKTGGGSIISISSTGNRVYIENYAGHGTCKAAVEVMVKYA
ASELGKIGIRANAVCGGPIDTDALKAFTNYEEVRDKTAQLSPLNRMGKPSDLAGACLFLC
SSKASWVTGHTFIVDGGTTFR
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggaaatgaataacgaatttaatggaaaaacgctggtaattagcggcggaacaagagga
atcggaagggcgatagtcgaagaatttgcgcaaaacggtgtaaatatcgcttttacctac
aattcaaacgaagagcttgcaaaaaaacaatgcgaagagcttgaaagcgaattcggcata
aaagcaagatgttatgcgctaaatatcttagagcctgcaacctataaagatcttttttta
gagattgacaatgatttcgatagaattgatttttttatttcaaatgctattatttcagga
cgcgcagtagccggcggatacacgaagtttatgagactcaaacctagaggattaaataat
attttcactgcaacagttgatgcctttatagttggtgctcaggaagccgcaaaaagaatg
gaaaaaactggtggcggttcaataatctcaatcagctcgacaggaaatcgcgtttatata
gaaaattatgcaggtcatggtacttgtaaagctgcggttgaagttatggttaaatatgca
gcgtctgaacttggtaaaattggaataagagccaatgcggtgtgtggcggacctattgat
accgacgctcttaaagcttttacaaattatgaggaagtaagggataaaaccgcgcaactt
agtccattgaatagaatgggtaaaccaagtgatttggcaggagcttgtctatttttatgt
tcaagcaaagcaagctgggtcacaggacatacttttatagtagatggcggaacgactttt
agataa

DBGET integrated database retrieval system