KEGG   Campylobacter hominis: CHAB381_0779Help
Entry
CHAB381_0779      CDS       T00577                                 

Gene name
tpiA
Definition
(GenBank) triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cha  Campylobacter hominis
Pathway
cha00010  Glycolysis / Gluconeogenesis
cha00051  Fructose and mannose metabolism
cha01100  Metabolic pathways
cha01110  Biosynthesis of secondary metabolites
cha01120  Microbial metabolism in diverse environments
cha01130  Biosynthesis of antibiotics
cha01200  Carbon metabolism
cha01230  Biosynthesis of amino acids
Module
cha_M00002  Glycolysis, core module involving three-carbon compounds
cha_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cha00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CHAB381_0779 (tpiA)
   00051 Fructose and mannose metabolism
    CHAB381_0779 (tpiA)
   00562 Inositol phosphate metabolism
    CHAB381_0779 (tpiA)
Enzymes [BR:cha01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CHAB381_0779 (tpiA)
Exosome [BR:cha04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CHAB381_0779 (tpiA)
  Exosomal proteins of bladder cancer cells
   CHAB381_0779 (tpiA)
  Exosomal proteins of melanoma cells
   CHAB381_0779 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM YkuI_C
Motif
Other DBs
NCBI-ProteinID: ABS51749
UniProt: A7I1G2
Position
721935..722633
Genome map
AA seq 232 aa AA seqDB search
MIVAANLKCNHTRASFLNFTKKLDNFLSGEASNFKKNEILIFPPNTAFCDQISNFTQGAQ
NFFPCENGSFTGEIGADMLNEFGIKSVLIGHSERRVIFSESDRMVLEKFKFAKKRGWRII
FCVGESDIVRMNGNYREVLSDQLSEIDLDYENLIIAYEPIWAIGTGKSAKNEQIEEVLEF
LAEKTEAPLLYGGSVNLKNISQISKLPHCSGVLIGSASWEAENFINLLKELQ
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgatagttgcagcaaatttaaaatgtaatcatacaagagcaagttttttaaattttaca
aaaaaattagacaattttttaagcggcgaagcttcaaattttaaaaagaatgaaatttta
atttttccaccaaatacggcattttgtgatcaaatttcaaattttactcaaggggcgcaa
aacttttttccttgtgaaaacggaagttttacaggtgaaatcggcgctgatatgttaaac
gagttcggtataaaatcagtacttattggacacagcgaaaggcgtgtgatttttagtgaa
agtgatagaatggtgcttgaaaagtttaaatttgccaaaaagcgcggttggcgcattatt
ttttgtgtcggcgagagcgacattgtgcgaatgaatggaaattacagagaagttttaagt
gatcaactcagcgaaatagatttggattatgaaaatttaatcattgcttatgagccgatt
tgggcaatcggtaccggaaaaagcgctaaaaatgagcagatagaagaagtgctggaattt
cttgcagaaaaaaccgaagcgccgcttttatatggtggaagtgtaaatcttaaaaatatt
tctcaaatttcaaaacttcctcattgcagcggcgttttaataggaagcgcaagctgggaa
gctgaaaatttcattaatttgttaaaggaattgcaatga

DBGET integrated database retrieval system