KEGG   Campylobacter hominis: CHAB381_1110Help
Entry
CHAB381_1110      CDS       T00577                                 

Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
cha  Campylobacter hominis
Pathway
cha00900  Terpenoid backbone biosynthesis
cha01100  Metabolic pathways
cha01110  Biosynthesis of secondary metabolites
cha01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cha00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CHAB381_1110
Enzymes [BR:cha01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     CHAB381_1110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: ABS51447
UniProt: A7I2C5
Position
1043265..1044014
Genome map
AA seq 249 aa AA seqDB search
MKSFAKINIFLKITGTRGNYHELNSRFVLIKNLFDEISFKSGNFEGFCIKTETEINGENI
INKAYNELCKAGFSHELNEFFKNNCVTLKKNIPLGGGLGGGSSNAATFLKMANEELNLKI
SKRNLMKIGAKIGADVSFFLSDEICANVSGIGEIIMPFDDEIPNFEILQKPVCCDTAKVY
KEFRAHFFDTINLKFSARLSRLKSSEILANFKNYMLNDLLVPAQKIYPNLKINNDEFLSG
SGSSCFKVK
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagttttgccaaaatcaatatttttttaaaaatcacaggaacaagaggaaattat
cacgaattaaactcaagatttgtgcttataaaaaatctttttgacgaaataagttttaaa
agcggaaattttgaaggtttttgtataaaaaccgaaaccgaaataaatggcgaaaacatt
ataaataaagcctataacgaactttgtaaggcaggtttttcccacgaattaaatgaattt
tttaaaaataactgcgtaactttaaaaaaaaatattccgcttggaggcggacttggaggt
ggaagttcaaatgccgccacttttttaaaaatggctaatgaagagctgaatcttaaaatt
tcaaaacggaatttaatgaaaataggcgctaaaataggcgctgacgtgagttttttttta
agcgatgaaatatgtgcgaatgtaagcggtataggagaaattataatgccgtttgatgat
gaaattccaaattttgaaattttacaaaaacctgtttgctgcgatacggcaaaagtttat
aaagagtttcgcgcgcacttttttgatactataaatttaaaattttcagctagactttca
cgtttaaaaagtagcgaaattttggcaaattttaaaaattatatgttaaatgacctgctt
gtgccggcacaaaaaatttatccaaatttaaaaatcaataacgatgaatttttgagcggc
agcggaagcagctgttttaaggtaaaataa

DBGET integrated database retrieval system