KEGG   Campylobacter hominis: CHAB381_1137Help
Entry
CHAB381_1137      CDS       T00577                                 

Definition
(GenBank) succinyl-CoA synthetase beta chain (SCS-alpha)(Vegetative protein 63) (VEG63)
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
cha  Campylobacter hominis
Pathway
cha00020  Citrate cycle (TCA cycle)
cha00640  Propanoate metabolism
cha00660  C5-Branched dibasic acid metabolism
cha01100  Metabolic pathways
cha01110  Biosynthesis of secondary metabolites
cha01120  Microbial metabolism in diverse environments
cha01130  Biosynthesis of antibiotics
cha01200  Carbon metabolism
Module
cha_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cha_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cha00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CHAB381_1137
   00640 Propanoate metabolism
    CHAB381_1137
   00660 C5-Branched dibasic acid metabolism
    CHAB381_1137
Enzymes [BR:cha01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     CHAB381_1137
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: ABS51959
UniProt: A7I2F2
Position
1073485..1074648
Genome map
AA seq 387 aa AA seqDB search
MNIHEYQAKELCREFGINVSNGALALSADEAVEVAKKLGGNVWAVKAQIHAGGRGLGGGV
KIAKNLDEVKKYANQILGMTLVTKQTGPKGKLVRKIYIEQGCNIKKEFYVSLTFNRAKEQ
IGLIASASGGMGIEEVDKNLIKTLNIDPQIGLKAFHAYEVGDFLGFDKDLNNKFYKFLNG
LYKLYIATDANLVEINPMVLTAEDEFFALDAKMGFDDAALFRHENIAAMRDLDEEESSEV
EAKQYGLSYVKLDGDIGCMVNGAGLAMGTMDTITYCGGKSANFLDVGGGASAETVAKAFE
IILRDKNVKSIFVNIFGGIVRCDRIAKGILEATKLTKVEIPVVVRLDGTNAKEAIELLKE
ANIENIYSAHDLEEGAKLAVKLVNGEK
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgaatatacatgaatatcaagcaaaagaactttgccgtgaatttggtataaatgtttca
aacggtgctttggcacttagcgcagacgaagcggttgaagtcgctaaaaaactcggtggc
aatgtttgggctgtaaaagcgcaaattcacgcaggcggtagaggtcttggaggcggtgta
aaaatcgctaaaaatttggatgaagttaaaaaatacgctaatcaaattttaggtatgacg
cttgttacaaagcaaacaggtccaaaaggcaaacttgtaagaaaaatttatatcgagcaa
ggttgcaacataaaaaaagaattttatgtaagccttacatttaaccgtgcaaaagagcaa
atcggccttatcgcttctgcaagcggcggaatgggaattgaagaggttgataaaaattta
attaaaactctcaatatagatccgcaaatcggcttaaaagcttttcatgcttatgaagtc
ggcgatttcttaggttttgacaaagatttaaataataaattttataaattcttaaacgga
ctttataaactatacattgcaacagacgcaaatttagtagagataaatcctatggtttta
actgccgaagatgaattttttgcgcttgatgcaaaaatgggatttgacgatgcggcactt
ttcagacacgaaaatatcgcagctatgagagatttagacgaagaagaatcaagcgaagtt
gaagctaaacaatacggtctcagctatgtaaaacttgacggagatatcggctgtatggta
aatggtgcaggactcgcaatgggtacaatggatacgattacatattgcggcggaaaatcg
gcaaactttcttgatgtaggcggcggcgcaagtgcggaaacagttgcaaaagcatttgaa
atcattttgcgcgacaaaaatgtaaaatctatttttgtaaatattttcggcggaattgtt
cgctgtgatagaatcgcaaaaggaattttggaagctacgaagcttacaaaagtagaaatt
cctgttgtagttagacttgatggaacaaatgcaaaagaggctattgaacttttaaaagaa
gcgaatatagaaaacatatacagcgcgcacgaccttgaagaaggcgcaaaacttgcagtt
aaactagtaaatggagaaaaataa

DBGET integrated database retrieval system