KEGG   Campylobacter hominis: CHAB381_1274Help
Entry
CHAB381_1274      CDS       T00577                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cha  Campylobacter hominis
Pathway
cha00260  Glycine, serine and threonine metabolism
cha00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cha01100  Metabolic pathways
cha01110  Biosynthesis of secondary metabolites
cha01130  Biosynthesis of antibiotics
cha01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cha00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CHAB381_1274 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CHAB381_1274 (trpB)
Enzymes [BR:cha01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CHAB381_1274 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP DUF3708
Motif
Other DBs
NCBI-ProteinID: ABS51187
UniProt: A7I2T4
Position
1210334..1211515
Genome map
AA seq 393 aa AA seqDB search
MNKKAYYGKFGGQFVPETAMFALEELEYAYKHITKTKEFKDELNWLLHEYVGRPSPLYYA
KKLSKYYGHEIYLKREDLNHTGAHKINNALGQALLAKKMGKTKVIAETGAGQHGVATATA
AALLGLECNIYMGEVDAARQRLNRFRMELLGAKVVEIRSGLRTLKEATTAAIQAWVNEIE
NVFYVIGSVVGPYPYPEIVKHFQSVIGKETKAQLKKMGIKADYIVACVGGGSNAMGIFSA
FLKDKNVNLCGVEAGGLGADTPYNAATLTNGKAGIIHGMKTIVLQDKYGRILPVHSISAG
LDYPGVGPEHSNLFDTGRAHYEAVSDDEAINALKLLCKTEGIIPAIESAHALAYLDKLCP
KLKGHKTIVVNVSGRGDKDIDSIINYKKGTIYG
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaataagaaagcgtattatgggaagtttggcggacaatttgtccctgaaacagcaatg
tttgcgttagaagaacttgaatatgcctacaaacatataacaaaaacaaaagaatttaaa
gatgagttgaactggttattgcatgaatatgtcggacgcccatcgccactttattatgcc
aaaaaacttagcaaatattacggacatgaaatttacttaaaacgcgaagatttaaaccat
accggcgcacacaaaataaataacgctctaggacaagctttgttagctaaaaaaatgggc
aaaacaaaggttatcgctgaaacaggagccggacagcacggcgtggctacagctacagcc
gctgctttactgggacttgaatgcaatatttatatgggcgaagtggatgcagcccgtcaa
agacttaacagatttagaatggaacttttaggcgcaaaagttgtagaaataagatcaggg
cttagaacactaaaagaggccacaacagcagcaattcaagcttgggtaaatgaaatagaa
aatgttttttatgtaataggttcagtcgtcggtccttatccttatcctgagattgtaaaa
cacttccaaagtgtaataggaaaagagacaaaagctcaacttaaaaaaatgggaataaaa
gccgattatatagtagcttgcgtaggcggcggaagtaatgctatgggaattttcagcgca
tttttaaaagataaaaacgttaatctttgcggcgttgaagcaggaggtcttggagccgat
actccttataatgcggcaactcttacaaatggtaaagctggcattattcacggaatgaaa
acaattgttttacaagataaatatggcagaattttgcctgtacacagtatttcggcagga
cttgattatcctggcgtaggacctgagcattcaaatctatttgacactggacgcgcacac
tatgaagctgtaagcgatgatgaagctataaatgcgcttaaattactttgcaaaaccgaa
ggaatcatcccggcaatcgaatcggcacacgctttggcatatttggataaactttgcccg
aaacttaaaggtcataaaactatagtcgtaaatgtgagtggcagaggtgataaagacata
gattcaatcataaactataaaaaaggaacaatttatggataa

DBGET integrated database retrieval system