KEGG   Campylobacter hominis: CHAB381_1275Help
Entry
CHAB381_1275      CDS       T00577                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cha  Campylobacter hominis
Pathway
cha00260  Glycine, serine and threonine metabolism
cha00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cha01100  Metabolic pathways
cha01110  Biosynthesis of secondary metabolites
cha01130  Biosynthesis of antibiotics
cha01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cha00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CHAB381_1275 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CHAB381_1275 (trpA)
Enzymes [BR:cha01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CHAB381_1275 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB BtpA PucR IGPS
Motif
Other DBs
NCBI-ProteinID: ABS51081
UniProt: A7I2T5
Position
1211508..1212251
Genome map
AA seq 247 aa AA seqDB search
MDKIKKAFENGANIGYIVAGYPNVEHTKNFLNSLDECALDIVEIGIPYSDPLADGPVVFN
ASFQAVQNGVNTDTVFKILSEVETKKPLIFLVYFNLIFAYGMKKFIKKCAEAGISGLIIP
DLPFEENEEIFKLCEKEKIALIPLISITSEHRAKKVLSRAGGFIYAISAIGVTGTKLTPM
ERLKNMLSDLKKMSDLPVAVGFGIRTNEDIRNMRKYADGVILGTSIVKLSEEFEGKEFLQ
KINELFK
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atggataagataaaaaaagcgtttgaaaatggagcaaatatcggttatatcgttgccgga
tatccaaatgtagagcatacgaaaaattttttaaattcacttgatgagtgcgcacttgat
attgttgaaataggtattccatattcagatcctttagctgatggacctgtggtgtttaac
gcaagctttcaggcggtgcaaaacggcgtaaatacggacactgtatttaaaattttaagt
gaagttgaaactaaaaaaccgcttatttttttagtttatttcaatttgatttttgcctac
ggaatgaaaaaatttatcaaaaaatgcgctgaagctggaatttcaggtttgataattccg
gatcttccttttgaggaaaatgaagaaatttttaaactttgtgaaaaagaaaaaatcgct
ttaataccgctaataagtataacaagcgaacatagagcaaaaaaagttttaagcagagct
ggcggatttatatacgcaatatcggcaataggcgtaacaggaacaaaactaactccaatg
gaaagactaaaaaatatgctttctgatcttaaaaaaatgagcgatttaccggtagctgtc
ggctttggtatacgcacaaacgaagatataagaaatatgcgcaaatacgcggacggtgta
atacttggaacttctatcgtaaaactttccgaagaatttgaaggtaaagagtttttacaa
aaaataaacgagctttttaaataa

DBGET integrated database retrieval system