KEGG   Campylobacter hominis: CHAB381_1500Help
Entry
CHAB381_1500      CDS       T00577                                 

Gene name
purE
Definition
(GenBank) phosphoribosylaminoimidazole carboxylase, catalytic subunit
  KO
K01588  5-(carboxyamino)imidazole ribonucleotide mutase [EC:5.4.99.18]
Organism
cha  Campylobacter hominis
Pathway
cha00230  Purine metabolism
cha01100  Metabolic pathways
cha01110  Biosynthesis of secondary metabolites
cha01130  Biosynthesis of antibiotics
Module
cha_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:cha00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    CHAB381_1500 (purE)
Enzymes [BR:cha01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.18  5-(carboxyamino)imidazole ribonucleotide mutase
     CHAB381_1500 (purE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIRC PrpR_N
Motif
Other DBs
NCBI-ProteinID: ABS52296
UniProt: A7I3E4
Position
complement(1438727..1439221)
Genome map
AA seq 164 aa AA seqDB search
MKFVSIIMGSKSDYEVVSECAKILKDFGVAYEMIISSAHRSPKRTAEYVANAEKKGAQVF
VCAAGMAAHLAGAVAANTTKPVIGIPMGGGALNGLDALYSTVQMPGGMPVATMSIAKAGA
KNAAYFALQILALSDEKLAEKLIEYRKDATKKIENDSKEIEVLL
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttgtttctattattatgggctcaaagagcgattatgaagttgttagcgagtgc
gccaaaattttaaaagatttcggtgtggcatatgaaatgattataagttcggcacatcgc
agtccgaaacgtacagccgaatatgtcgcaaatgccgaaaaaaaaggcgcacaagttttt
gtatgtgcagccggaatggcggctcatctggcaggagctgttgctgcgaacactacaaag
cctgtaatcggaatcccgatgggtggcggagcgttaaatgggcttgacgcactttattcg
acagttcaaatgccaggaggtatgcctgtggctactatgagtatcgcaaaagccggagcc
aaaaatgcggcttattttgcattgcaaattttggctttaagtgatgaaaaacttgctgaa
aaactaatcgaataccgcaaagatgcgacaaaaaaaatagagaacgattcaaaagagatt
gaagttctgctttaa

DBGET integrated database retrieval system