KEGG   Chlamydia psittaci C19/98: CPS0C_0073Help
Entry
CPS0C_0073        CDS       T01863                                 

Definition
(GenBank) phosphate transporter family protein
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
chc  Chlamydia psittaci C19/98
Brite
KEGG Orthology (KO) [BR:chc00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    CPS0C_0073
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AEG85118
Position
74800..76080
Genome map
AA seq 426 aa AA seqDB search
MLALLIFVLLCGFYTSWNIGANDVANAVGPSVGSGVLTLRQAVVIAAIFEFLGALFLGDR
VAGTIESHIVSVSDPLIASGEYVYGMTGALLATGVWLQLASYFGWPVSTTHSIVGAVIGF
GLVLGKGTVIYWGSIGAILVSWVISPLMGGCIAYTIFSFIRRNILYKNDPVGAMIRIAPF
LAAFVFVVLGIIIVCGGVVTRLIPLPWALALVFLVGSIAYTIMFKYVHTPHCSFISASPK
SGSLLCRLKTCGGNYGRKYLIVERIFAYLQIIIACFMAFAHGSNDVANAIAPVAGVLRQV
YPQVYSSYTLIGLMAFGGVGLIIGLSIWGWRVIETVGCKITELTPSRGFSVGLSSAVTIA
LASAIGLPISTTHVVVGAVLGIGLARGIHAINLNIIKDIIMSWFITLPAGAVLSILFFFA
LRALFQ
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgcttgccttactcatttttgttctcttatgtggtttctacacctcttggaatatagga
gctaacgatgttgctaatgctgttggccccagtgtaggatccggagtattaacactacga
caagctgtagtcattgccgctatttttgaatttttaggagcgttattcctaggagatcgt
gtagcaggaaccatagaaagtcatattgtttctgtttcagatcctttaatagcttctggg
gagtacgtttatgggatgacaggagccttgttagctacaggagtttggctacaattggcc
tcctattttggatggccggtctctacaacccattctatagttggagcggtgataggtttt
ggtctcgtccttggaaaaggaacagtgatttactggggatctataggggcgattttagtt
agttgggtaatctctccattaatggggggatgcattgcctatacaatcttctcttttata
cgtaggaatattctttataagaatgaccccgtaggagcaatgattcgcatagctcctttt
cttgctgcttttgtcttcgtcgttttagggattattattgtttgcggaggggtagtcacc
cggttgattcctttaccctgggctttggcattagtgttcttagtcgggagtattgcttat
acaattatgtttaaatatgtgcatacgccacactgttcttttatttctgcttcgcctaaa
tcagggagtttactttgtcgtttaaaaacatgcggaggaaactacggtagaaagtatctc
atcgtagaaagaatctttgcttacttacaaattattatcgcatgttttatggcttttgct
cacggatctaatgacgttgctaatgccatagctccggttgctggagttttacgacaggta
tatcctcaagtatattcttcctatacgttaatcggtcttatggcgtttggtggtgtggga
ttgatcatagggttatctatttggggatggcgagtaattgaaaccgtaggatgtaagatt
acagaactcacaccttcaagagggttttctgtaggtttaagttctgctgtgaccattgct
ttagcttcagctataggtttacccatatcaacaacacatgtagttgtcggagctgtctta
ggtataggcttagctcggggtatccatgcgattaatttaaatattattaaagacattatc
atgtcgtggtttatcactcttccagcaggagcagttctctctattctatttttctttgct
ttaagagcgctcttccagtaa

DBGET integrated database retrieval system