KEGG   Caldicellulosiruptor hydrothermalis: Calhy_1461Help
Entry
Calhy_1461        CDS       T01346                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
chd  Caldicellulosiruptor hydrothermalis
Pathway
chd00010  Glycolysis / Gluconeogenesis
chd00030  Pentose phosphate pathway
chd00051  Fructose and mannose metabolism
chd00052  Galactose metabolism
chd00680  Methane metabolism
chd01100  Metabolic pathways
chd01110  Biosynthesis of secondary metabolites
chd01120  Microbial metabolism in diverse environments
chd01130  Biosynthesis of antibiotics
chd01200  Carbon metabolism
chd01230  Biosynthesis of amino acids
chd03018  RNA degradation
Module
chd_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:chd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Calhy_1461
   00030 Pentose phosphate pathway
    Calhy_1461
   00051 Fructose and mannose metabolism
    Calhy_1461
   00052 Galactose metabolism
    Calhy_1461
  Energy metabolism
   00680 Methane metabolism
    Calhy_1461
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Calhy_1461
Enzymes [BR:chd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Calhy_1461
Protein phosphatases and associated proteins [BR:chd01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Calhy_1461
Messenger RNA biogenesis [BR:chd03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Calhy_1461
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-ProteinID: ADQ07178
UniProt: E4QB85
Position
complement(1491895..1492863)
Genome map
AA seq 322 aa AA seqDB search
MPEVRTIGVLTSGGDAPGMNAAIRAVVRTGIYYGFRVMGIRRGYNGLIEGDIFEMNLRSV
SDIIQRGGTILLTARSPEFMTENGLKKAASMCKIFKIDALVVIGGDGSFRGARDLSKFGI
NVVGIPGTIDNDIACTDYTIGFDTALNTVQDAINKIRDTATSHERVSILEVMGRHAGYIA
LYSGIAGGAESIVIPEKGLDKDEIIRRIIDGKNKGKLHNLIILAEGIGGATELAKEIEEA
TGIETRATILGYIQRGGSPTAYDRVVASLMGAKAVEVIKEGKQNRIIAMKDGKIVDYDID
EALSMQKTIDEYMYNLATILSL
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgccagaagtgagaactattggtgttttgacaagtggtggcgacgcaccaggaatgaac
gctgctattcgtgctgttgtgagaactggtatatactatggatttagagtaatgggtata
agacggggttataatggtcttattgagggcgatatttttgagatgaacttaaggtctgtt
tcagatataatccaacgtggtggaaccatacttttgactgcaaggtctcctgagttcatg
acagaaaatggactcaaaaaagctgcttcaatgtgcaagatattcaagatagatgctctt
gttgtaattggtggagatgggtctttcagaggggcaagagacttgagtaaatttggtata
aatgttgttggaattcccggaaccattgacaatgacatcgcatgtacagactacactatt
ggttttgatacagcattgaatactgttcaggatgcaattaacaagataagagatacagca
acctctcatgaaagagttagtattcttgaggtaatgggacgtcatgccgggtatattgct
ctttatagtggtattgcaggcggtgctgagtcgattgtgattcctgaaaaaggtcttgac
aaggatgagataataagaagaataattgatgggaaaaacaaaggaaagcttcacaacttg
attatattggctgagggaattggtggagcaacagagcttgcaaaggagattgaagaagca
actggaatagagacaagagcaaccatccttgggtatattcagagaggcggctcgcctact
gcgtatgacagagttgttgcaagtttgatgggggcaaaagctgttgaggttatcaaagaa
ggtaagcagaacaggataattgcaatgaaggatggcaagattgttgattatgatattgac
gaagcactttctatgcaaaagacaattgatgaatacatgtacaatttagctactatcctt
tctttataa

DBGET integrated database retrieval system