KEGG   Caldicellulosiruptor hydrothermalis: Calhy_2065Help
Entry
Calhy_2065        CDS       T01346                                 

Definition
(GenBank) aspartyl-tRNA synthetase
  KO
K01876  aspartyl-tRNA synthetase [EC:6.1.1.12]
Organism
chd  Caldicellulosiruptor hydrothermalis
Pathway
chd00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:chd00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Calhy_2065
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:chd01007]
    Calhy_2065
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:chd03016]
    Calhy_2065
   03029 Mitochondrial biogenesis [BR:chd03029]
    Calhy_2065
Enzymes [BR:chd01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.12  aspartate---tRNA ligase
     Calhy_2065
Amino acid related enzymes [BR:chd01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   Calhy_2065
Transfer RNA biogenesis [BR:chd03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Calhy_2065
 Prokaryotic Type
   Other AARSs
    Calhy_2065
Mitochondrial biogenesis [BR:chd03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Calhy_2065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2 GAD tRNA_anti-codon tRNA-synt_2d AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: ADQ07775
UniProt: E4QEF6
Position
complement(2124642..2126426)
Genome map
AA seq 594 aa AA seqDB search
MEGIKGFKRTKYCAEVSLEDVGKEVVLTGWVDTRRDLGGIIFVDLRDRTGIVQVVFDEKM
GEELLDKADSLRSEYCIGVRGIVEKRPPETVNPKIKTGEVEVRATELRIFNKSETPPFPI
EEGINVNEAVRLKYRYLDLRRPDMQRNLMFRHKLYQVVRNFLSQNGFIEIETPMLTKSTP
EGARDYLVPSRIFPGKFFALPQSPQLFKQLLMVAGFDRYFQIVKCFRDEDLRADRQPEFT
QIDIEMSFVDVDDVIEINEKLLKTIFGEMLGIDLKLPLPRLTYKEAMERFGSDKPDTRFG
MELVDITDIVKNCEFKVFSDAANKGGSVRAINAKGCAATFSRREIDALVEFAKNFKAKGL
AWIAVESDGLKSPIVKFLKEEEINEILKRLGAEVGDLLLFSADKDEIVFDVLGNLRLEIA
RKLNLLDKSKFNLLWVVEFPLFEYSEEEGRFVAKHHPFTSPMDEDLEYLETDPAKVRSKA
YDIVLNGTEIGGGSIRIHSPEIQKRMFKALGFTEEKAQDRFGFLLEAFKYGTPPHGGIAY
GFDRLCMLLLGLDSIRDTIAFPKVKDSSCPLTDAPSEVEPKQLRELHIKVDVVK
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
gtggaaggtattaaggggtttaaaagaacaaaatactgtgcagaagtatcgcttgaggat
gttggaaaagaagttgtgctaacaggttgggttgatacaagacgtgaccttggcgggata
atctttgttgatttgagggacagaacaggtattgtacaggttgtgtttgatgagaagatg
ggagaagaacttttagacaaggctgactcattaaggtccgaatactgtatcggtgttaga
ggtattgtggagaaaagaccacctgagacagtaaatccaaagataaaaacaggcgaggta
gaagtaagagcaacagaactgaggatatttaacaagtctgagacgcctccttttccgatt
gaagaggggataaatgtaaatgaagcagtaagattaaaatacaggtatttggacttaaga
agacctgatatgcagagaaatttgatgttcagacacaagctctatcaggttgtgcgaaat
tttctttctcaaaatgggtttatagagatagaaacacccatgctcacaaaatccactcca
gaaggtgcaagagactacttagttccaagcagaatatttccgggaaaattttttgcgctg
ccacagtcaccgcagctttttaaacagcttttgatggttgcagggtttgacagatatttt
cagattgtaaaatgttttagagatgaagacctgcgagcagacagacaacctgagtttacc
cagatagacattgagatgtcgtttgttgatgttgacgatgttattgagataaatgaaaaa
cttctcaagaccatttttggagagatgctggggatagacttaaaacttcctcttccaaga
cttacctacaaggaagcaatggaaaggtttggctcagacaaaccagatactcgttttgga
atggaacttgttgatattactgacattgtaaaaaactgcgaatttaaagtattttctgat
gcagcaaacaaaggtgggtcagtaagagctatcaatgcaaagggctgtgcggctacattt
tcaaggcgtgagattgatgcacttgttgagtttgcaaaaaactttaaagcaaaaggtctt
gcatggattgcagttgaaagtgatggtctgaaatctcctattgttaagtttttaaaagaa
gaggagataaatgaaattctaaagagacttggtgcagaggttggagatttgctgctattt
tctgctgataaggatgaaattgtctttgatgttcttggaaacttgagacttgagatagca
agaaagttaaaccttcttgacaagtcaaagtttaatcttttgtgggtagtagagtttcca
ctttttgaatattcagaggaagagggcaggtttgttgcaaaacaccatccatttacttcg
ccaatggatgaagatttagaatatttagaaactgatccagcaaaagtaagatcaaaagca
tacgatattgtgttaaacggtacagaaattggcggtggttctatcagaattcactcacct
gagattcaaaagagaatgttcaaagcccttggatttacagaggaaaaggcacaggatagg
tttggctttttgcttgaagctttcaagtacggtacaccaccacacggtggtatagcttat
ggatttgataggctttgcatgctgcttttgggtttggattctatcagagacacaattgcg
ttcccgaaggtaaaagattcgtcgtgcccgctgactgatgcaccctctgaggttgaacca
aaacagctcagagagcttcacatcaaggttgatgttgtaaaataa

DBGET integrated database retrieval system