KEGG   Chelatococcus sp. CO-6: AL346_09265Help
Entry
AL346_09265       CDS       T04040                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
chel  Chelatococcus sp. CO-6
Pathway
chel00071  Fatty acid degradation
chel00072  Synthesis and degradation of ketone bodies
chel00280  Valine, leucine and isoleucine degradation
chel00310  Lysine degradation
chel00362  Benzoate degradation
chel00380  Tryptophan metabolism
chel00620  Pyruvate metabolism
chel00630  Glyoxylate and dicarboxylate metabolism
chel00640  Propanoate metabolism
chel00650  Butanoate metabolism
chel00900  Terpenoid backbone biosynthesis
chel01100  Metabolic pathways
chel01110  Biosynthesis of secondary metabolites
chel01120  Microbial metabolism in diverse environments
chel01130  Biosynthesis of antibiotics
chel01200  Carbon metabolism
chel01212  Fatty acid metabolism
chel02020  Two-component system
Brite
KEGG Orthology (KO) [BR:chel00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AL346_09265
   00630 Glyoxylate and dicarboxylate metabolism
    AL346_09265
   00640 Propanoate metabolism
    AL346_09265
   00650 Butanoate metabolism
    AL346_09265
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AL346_09265
   00072 Synthesis and degradation of ketone bodies
    AL346_09265
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AL346_09265
   00310 Lysine degradation
    AL346_09265
   00380 Tryptophan metabolism
    AL346_09265
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AL346_09265
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AL346_09265
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AL346_09265
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:chel04147]
    AL346_09265
Enzymes [BR:chel01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AL346_09265
Exosome [BR:chel04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AL346_09265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: ALA17561
UniProt: A0A0K2DC89
Position
complement(1969855..1971033)
Genome map
AA seq 392 aa AA seqDB search
MASTDIVIVAATRTAVGSFNGAFANVPAHVLGATAIKGALERAGVAAEEVDEVILGQVLT
AAEGQNPARQAAMKAGIPVDKTAWSLNQVCGSGLRAVALGMQQIANGDASVIVAGGQESM
SLAPHAAHMRAGTKFGDVQFVDTMIRDGLWDAFHGYHMGVTAENVAQKWQISREEQDAFA
VASQNKAEAAKKAGRFAKEITPVTVASRKGDVVVDTDEYIRDGATLDAVAKLRPAFQKDG
TVTAGNASGLNDGAAALVLMTAAEAERRGLKPIARIASWATAGVEPAVMGSGPIPASRKA
LEKAGWKAQDLDLVEANEAFAAQALAVNKDMGWNPDIVNVNGGAIAIGHPIGASGARILT
TLLHEMGRRDAKKGLATLCIGGGMGVAMCVER
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atggcctccacggacatcgtcatcgtcgccgccacgcgcactgcggtcggctccttcaac
ggcgccttcgccaacgtgcccgcgcatgtgctgggcgccaccgccatcaagggcgccctc
gagcgggcgggcgtcgccgccgaggaggtcgacgaggtcatcctcggccaggtgctgacg
gccgccgaaggacagaacccggcccgccaggccgccatgaaggcgggcatcccggtcgac
aagacggcttggagcctcaaccaggtctgcggctcgggcctgcgcgccgtcgccctcggc
atgcagcagatcgccaacggcgacgcttccgtcatcgtcgccggcgggcaggaatcgatg
tcgctggcgccgcacgcggcccacatgcgtgccggcacgaagttcggcgacgtgcagttc
gtcgacacgatgattcgcgacgggctgtgggatgccttccacggctaccacatgggcgtg
acggccgagaacgtggcccagaagtggcagatcagccgcgaggagcaggacgccttcgcc
gtcgcctcccagaacaaggcggaagccgccaagaaggccggccgcttcgcgaaggagatc
acgcccgtgacggtcgcctcgcgcaagggcgacgtcgtcgtcgacaccgacgagtacatc
cgcgacggggcgaccctcgacgcggtcgccaagctgcggcccgccttccagaaggacggc
acggtgacggcgggcaacgcctcgggcctcaacgacggggccgcggcgctcgtgctgatg
acagcggccgaagccgagcggcgcggcctcaagccgatcgctcgcatcgcctcctgggcg
acggccggcgtcgagcccgccgtcatgggctcgggccccatccccgcctcgcgcaaggcc
ctcgagaaggcgggctggaaggcgcaggacctcgacctcgtcgaggccaacgaggccttc
gccgcccaggcgctcgccgtcaacaaggacatgggctggaacccggacatcgtgaacgtc
aatggcggggccatcgccatcggccatcccatcggcgcctccggcgcgcgcatcctgacg
accctgctgcacgagatgggccggcgcgacgcgaagaagggcctcgcgacgctgtgcatc
ggcggcggcatgggcgtcgccatgtgcgtggagcgctga

DBGET integrated database retrieval system