KEGG   Chelatococcus sp. CO-6: AL346_12955Help
Entry
AL346_12955       CDS       T04040                                 

Definition
(GenBank) hypothetical protein
  KO
K20866  glucose-1-phosphatase [EC:3.1.3.10]
Organism
chel  Chelatococcus sp. CO-6
Pathway
chel00010  Glycolysis / Gluconeogenesis
chel01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:chel00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AL346_12955
Enzymes [BR:chel01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.10  glucose-1-phosphatase
     AL346_12955
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like
Motif
Other DBs
NCBI-ProteinID: ALA18149
UniProt: A0A0K2DE93
Position
complement(2754268..2754882)
Genome map
AA seq 204 aa AA seqDB search
MPSPIRLAIFDMDDVLCHYDRDRRLAELSRLSGRSINEILTDIWASGFEDRADAGAMDAE
TYLSGFGERLGYAITRDEWVEARRLGMVPFPDSLALLARVKEKATVAVLTNNGFLTGEEI
DRLFPGLRRLVDDRVFVSARFGTKKPDPEIYRRLCAEFGVAPEEAFFTDDKPWNVAGAVK
AGLEGHVFDGAEGLRRALSRLALV
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgccgtcccccatccgcctcgccatcttcgacatggacgacgtgctgtgccactacgac
cgcgaccggcgcctcgccgagctgtcgcgcctgtcgggccgaagcatcaacgagatcctg
acggatatctgggcgagcggcttcgaggaccgggccgatgccggggcgatggatgccgag
acctatctttccggtttcggcgagcgtctcggctatgccatcacgcgcgacgaatgggtg
gaggcgcgccgcctcggtatggtgcccttccccgacagcctggcgctgctcgcccgcgtg
aaggagaaggcgaccgtcgccgtgctcaccaacaacggcttcctcaccggcgaggagatc
gaccggctcttcccggggctgcgccgcctcgtcgacgaccgggtgttcgtgtcggcccgc
ttcggcacgaagaagcccgatcccgagatctaccggcgcctgtgcgccgaattcggcgtc
gcccccgaggaggccttcttcaccgacgacaagccgtggaatgtcgcaggcgcggtgaag
gccggcctcgaaggccacgtcttcgacggcgccgagggcctgcggcgcgcgctctcccgc
ctcgcgctggtgtga

DBGET integrated database retrieval system