KEGG   Chelatococcus sp. CO-6: AL346_18165Help
Entry
AL346_18165       CDS       T04040                                 

Definition
(GenBank) FAD-dependent oxidoreductase
  KO
K05712  3-(3-hydroxy-phenyl)propionate hydroxylase [EC:1.14.13.127]
Organism
chel  Chelatococcus sp. CO-6
Pathway
chel00360  Phenylalanine metabolism
chel01100  Metabolic pathways
chel01120  Microbial metabolism in diverse environments
chel01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:chel00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    AL346_18165
Enzymes [BR:chel01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.127  3-(3-hydroxyphenyl)propanoate hydroxylase
     AL346_18165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_3 Pyr_redox Pyr_redox_2 DAO ApbA FAD_binding_2 Rossmann-like Pyr_redox_3 NAD_binding_8 HI0933_like NAD_binding_7 Lycopene_cycl UDPG_MGDP_dh_N GIDA
Motif
Other DBs
NCBI-ProteinID: ALA18980
UniProt: A0A0K2DGH6
Position
complement(3878076..3879695)
Genome map
AA seq 539 aa AA seqDB search
MVNAQGIPVYKKIGATPAPAVPEDRARVVIVGAGPVGLAMALDLGRRGHPVTVVTRLDFI
AHCSKAICFSKRSLDILDRLGVGDPVVEKGVTWNVGKVFWGAGDTPVYQFDMLPVKGQKR
PGFINIQQYYLEEYLLDGLRVLPNVEIRWGHTVEGVTPANDGVALEIATAGGRYRLRTEW
LIACDGSRSTVRDRLGLDFEGRVFEDNFLIADIRMKNREMPCERWFWFDPPFNPGKSALM
HRQPDDVWRLDFQLGWNIDREAAIRPENVEPYIRAMLGEDVAFEREWYSVYTFQCRRMAR
FVHARTIFAGDAAHLVSPFGARGCNGGFADIDNLGWKLDLVLRGEAGEDLIETYNEEAIV
TADENILNSTRSTDFLTPKSTASQALRDAVLELAHDHAFARPFVNSGRLSTPVSYPASRL
SIPDEDDWAGGVPPGSPVLDAPHGDGWLLDQLGNDFVLLTRGGRGEVPAGLRVISVAGVA
ADRLSLEEGGACLVRPDQYVAARWKRPDAVKIAAALARAKGGEADMGGEADMRGETWRN
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atggtgaatgcccagggcatccccgtgtacaagaagatcggcgccacccctgcccccgcc
gtgcccgaggaccgcgcccgggtcgtcatcgtgggcgccggaccggtgggcctcgccatg
gcgctcgacctcggccgccgcggccacccggtgacggtcgtcacgcggctcgacttcatc
gcccattgctccaaggcgatctgcttctccaagcgctcgctggacattctcgaccgcctc
ggcgtgggcgacccggtcgtcgaaaagggcgtgacctggaatgtcggcaaggtcttctgg
ggcgcgggcgatacccccgtctaccagttcgacatgctgccggtgaagggccagaagcgt
cccggcttcatcaacatccagcaatattacctcgaggaatatctgctcgacggtctccgc
gtcctgcccaatgtcgagatccgctggggccacacggtcgagggcgtcacgcccgcgaac
gacggtgtcgcgctggagatcgcgaccgccggcggccgctacaggctccggacggaatgg
ctgatcgcctgcgacggctcgcgctcgaccgtgcgcgatcggttggggctcgatttcgag
ggtcgcgtcttcgaggacaacttcctgatcgccgacatccggatgaagaaccgcgagatg
ccttgcgagcgctggttctggttcgatccgcccttcaatcccggcaagtcggcgttgatg
caccgccaacccgacgacgtctggcggctcgacttccagctcggctggaacatcgatcgc
gaggcggccatccgccccgagaacgtggagccctatatccgcgccatgctgggcgaggac
gtcgccttcgagcgcgaatggtacagcgtctacaccttccagtgccgccgcatggcgcgc
ttcgttcacgcccggaccatcttcgccggggatgcggcgcatctcgtctcgcccttcggg
gcccggggctgcaacggcggcttcgccgacatcgacaacctcggctggaagctcgatctc
gtcctgcgcggcgaggccggcgaggatctgatcgagacctataatgaggaggcgatcgtc
acggcggacgagaacatcctgaactcgacccgctcgaccgatttcctgacgccgaagtcg
acggcgagccaggcgttgcgcgatgcggtgctggaactggcgcatgaccatgccttcgcc
cggcccttcgtgaactcgggccggctgtccacaccggtgagctatcccgcgagccggctc
tcgatcccggacgaggacgactgggccggcggcgtgccccccggcagcccggtgctggac
gccccgcacggcgacggctggctgctggatcagctgggcaacgacttcgtgctgctgacc
cgcggcgggcggggcgaggtgccggccgggctgcgcgtcatttccgtcgcgggcgtggcc
gcggaccgcctgtcgctggaggaaggcggcgcctgcctggtgcgtcccgaccaatatgtc
gccgcgcgctggaaacggccggatgcggtgaagatcgcagcggctctcgctcgtgccaag
ggtggcgaggcggatatgggaggcgaggcagatatgcgaggagagacatggcgcaactga

DBGET integrated database retrieval system