KEGG   Chelatococcus sp. CO-6: AL346_18295Help
Entry
AL346_18295       CDS       T04040                                 

Definition
(GenBank) D-ribose transporter ATP-binding protein
  KO
K10562  rhamnose transport system ATP-binding protein [EC:7.5.2.-]
Organism
chel  Chelatococcus sp. CO-6
Pathway
chel02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:chel00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    AL346_18295
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:chel02000]
    AL346_18295
Transporters [BR:chel02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Rhamnose transporter
    AL346_18295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N RsgA_GTPase AAA_29 AAA_16 AAA_30 AAA_22 MMR_HSR1 AAA_23 AAA_15 DUF815 MukB
Motif
Other DBs
NCBI-ProteinID: ALA19001
UniProt: A0A0K2DGD4
Position
3905835..3907352
Genome map
AA seq 505 aa AA seqDB search
MSVVQVVAEPAHPLLEMRGISKSFPGVKALDGVDVALCAGTVTALIGENGAGKSTLVKVL
TGIYQPDAGDILIDGAPVRLADAQAAMRAGITAIHQETVLFDELTVAENIFLGHAPKTRL
GLVDWAAMRARAGALLHSIDAPISPYARLKDLSIAQRHLVAIARALSVEARVVIMDEPTA
ALSYKEVEDLFRIIERLKGQGKAILFISHKFEEVYEIAERFVVFRDGRSVGAGRLAETGQ
DEIVRMMVGRSVEHVFPKVEVAIGGPVLEVAGYSHPTEFADISFTLRRGEILGLYGLVGA
GRSEFCQALFGITRPSAGRLALEGRALTVRSPQDAIAAGIVYVPEERGRHGAVLPMPIFQ
NVSMAVLGRTTRAGFLRLAEEFALARRYAERLDLRAAALSVPVGTLSGGNQQKVVIAKWL
ATLPKVIILDEPTKGIDIGSKAAVHAFMSELAAEGLSVIMVSSELPEILGMSDRVMVMRE
GRLTGIWERDGLDAETLVRAATGNA
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtcgttcaagtggtcgccgagccggcccatcccctcctggagatgcgcggcatc
tcgaagtccttcccgggcgtcaaggcgctcgacggggtcgatgtcgctctttgcgccggc
accgtcaccgcgctcatcggggagaacggcgccggcaagtcgacgctggtcaaggttctc
accggcatctaccagccggacgccggcgacatcctcatcgacggggcgcccgtccgcctt
gccgatgcccaggccgcgatgcgcgcgggcatcaccgccatccaccaggagacggtgctg
ttcgacgaactgacggtagccgagaacatctttctcggccacgcgccgaagacacgcctc
ggcctcgtcgactgggcggcgatgcgggcgcgggccggggcgctgctgcactccatcgac
gcgccgatcagcccctatgcgcggctgaaggacctctccatcgcccagcgccatctcgtc
gccatcgcgcgggcgctctccgtcgaggcgcgggtcgtcatcatggacgagccgacggcg
gcgctctcctacaaggaggtggaggaccttttccgcatcatcgagcggctgaaggggcag
ggaaaggcgatcctcttcatcagccacaagttcgaggaggtctacgagatcgcggagcgc
ttcgtcgtctttcgcgacggccgctcggtcggcgcggggcgtctcgccgagacgggccag
gacgagatcgtgcgcatgatggtcggccggtcggtcgagcacgtcttcccgaaggtggag
gtcgccatcggcgggccggtgctcgaggttgcgggctattcgcacccgaccgaattcgcc
gacatctccttcacgctgaggcgtggcgagatcctcggcctctacggcctcgtcggcgcc
gggcgctccgagttctgccaggcgctgttcggcatcacccgcccgagcgccgggcgcctc
gcgctggagggcagggcgctcaccgtccgctcgccgcaggatgcgatcgcagccggcatc
gtctacgtgccggaggagcgcgggcggcacggggccgtgctgccgatgccgatcttccag
aacgtctccatggccgtgctcggccggacgacgcgggcgggcttcctgcgcctcgccgag
gaattcgcgctcgcccgccgctatgccgagcggctcgacctgcgcgcggcggcgctgtcc
gtgccggtcggcacgctgtcgggcggcaaccagcagaaggtcgtcatcgccaagtggctg
gcgacattgccgaaggtcatcatcctcgacgagccgacgaagggcatcgacatcggctcc
aaggctgccgtgcatgccttcatgagcgagctcgcggccgagggcctgtcggtgatcatg
gtctcgtcggaactgcccgagatcctcggcatgtcggaccgggtgatggtgatgcgcgag
ggccgcctgacgggcatctgggagcgcgacgggctcgacgccgagaccctggtgcgcgcc
gcaacgggcaatgcgtga

DBGET integrated database retrieval system