KEGG   Capnocytophaga haemolytica: AXF12_01525Help
Entry
AXF12_01525       CDS       T04287                                 

Definition
(GenBank) NAD(P)H-dependent oxidoreductase
  KO
K10679  nitroreductase / dihydropteridine reductase [EC:1.-.-.- 1.5.1.34]
Organism
chg  Capnocytophaga haemolytica
Pathway
chg00633  Nitrotoluene degradation
chg01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:chg00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    AXF12_01525
Enzymes [BR:chg01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.34  6,7-dihydropteridine reductase
     AXF12_01525
  1.-  
   1.-.-  
    1.-.-.-  
     AXF12_01525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Nitroreductase TM1586_NiRdase Methyltransf_29 V-ATPase_H_N
Motif
Other DBs
NCBI-ProteinID: AMD84329
UniProt: A0A125S285
Position
329893..330492
Genome map
AA seq 199 aa AA seqDB search
MNFLELAQSRYTTKAYRSQFVSEDKIQSLKEILRLTPSSINSQPWQFVFIDDKATKEQFA
RISYINEQRINEASHLVVFLAHNNDSAFEAHLHKTSEMGYGFYEKIQKPRGAAFVQEWID
RQVYIALGFFLSACAAMGIDSTPMEGILIEEYDRLLKVDGYKTLFAVAIGYRSDDDRNQP
SQRPKTRLPLTDVVKEFKL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgaattttttagaattagcacagagccgatataccactaaggcgtatcgctcacagttc
gtaagtgaggataagatacagagcctcaaggagatacttcgtcttaccccctcatcgatc
aactcgcaaccttggcagtttgtcttcattgacgacaaggctactaaggagcagtttgcg
cgcatctcgtacatcaatgagcaacgcataaatgaagcgagccacttagtggtattcctc
gcccacaataacgacagtgccttcgaggcgcacctccacaaaacctctgagatgggttat
ggcttctacgagaagatacaaaagccccgaggagctgccttcgtacaggagtggatcgac
cgacaggtgtacatcgcccttgggtttttcctcagtgcgtgtgccgcgatgggtattgat
agcacccctatggagggtatcctcattgaggagtacgaccgcctactgaaagtcgatggt
tacaaaaccctctttgctgtggcaatcggctaccgcagtgacgacgaccgtaaccagcca
tcacaacgacctaaaacgcgcttgcctctcaccgatgtggtaaaggagtttaagttatag

DBGET integrated database retrieval system