KEGG   Capnocytophaga haemolytica: AXF12_10500Help
Entry
AXF12_10500       CDS       T04287                                 

Definition
(GenBank) formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
chg  Capnocytophaga haemolytica
Pathway
chg00670  One carbon pool by folate
chg01100  Metabolic pathways
chg01120  Microbial metabolism in diverse environments
chg01200  Carbon metabolism
Module
chg_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:chg00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    AXF12_10500
Enzymes [BR:chg01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     AXF12_10500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS AAA_26
Motif
Other DBs
NCBI-ProteinID: AMD85904
UniProt: A0A0X8JC88
Position
2366890..2368566
Genome map
AA seq 558 aa AA seqDB search
MDFPTDLNIAQRASMQPITEVAKKLGISPEDLEPYGKYKAKLPLSLIKETSSPRGKLVLV
TAITPTPAGEGKTTVSIGLTEGLNKIGKRAIAVLREPSLGPVFGIKGGAAGGGYSQVVPM
EDINLHFTGDFAAIEKANNLLSAVIDNNIQSKTHSIGIDPRTVVWKRVMDMNDRALRHIV
VGLGGTANGVPREDGFNITPASEIMAILCLAESFSDLKRRLGNIYIGKKFDGTPVFARDL
KAVGAMALLLKDAIKPNLVQTLENNPAIIHGGPFASIAQGTNSVLATKLGLSLADYTVTE
AGFGADLGAEKFFDIKCTSAGLAPDAVVIVATVRALRHHGGAKKDEYNTPSTERVALGLP
NLEKHIENIQLFGVECVVAINAFPSDTPEEVALIEQCCAAKGVRAIVSRGFAEGGKGTQA
LAEAVVALAENGKSHFRPLYRNEDSIEDKISCIATKIYGASGVVYSSKAQKELKEIKKLG
FDTLPVCMVKTPKSLSDDEKKLSRPRQFEITVREFEFASGAGFVIPILGDTMRMPGLPSV
PAAEAMDIDDNGVITGLS
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atggactttccgacagatcttaacatcgcacaacgtgcatcgatgcaacccataactgag
gttgctaaaaaattaggcatttcgccagaggatttagagccgtatggcaagtataaggca
aaactccctttgagccttatcaaagaaaccagctcgccacgaggtaagttggtgctggtt
accgccatcacacctacgccagcaggcgaaggaaaaaccactgtcagtatagggctcacc
gagggcttgaacaagataggaaagcgcgccatcgctgttcttcgcgaaccttctttgggt
cctgtcttcggaatcaaaggcggcgcggcaggtggcggctactcacaggtcgtaccgatg
gaagacatcaatctacacttcacgggcgacttcgcagcaatcgagaaagcaaataacctc
ctctcggctgtgatagataacaacattcagagcaaaacccattcgatcgggatcgatcca
cgcaccgtcgtgtggaaacgcgtgatggatatgaacgatcgcgccctccgccacatcgtc
gttgggctgggaggcactgccaacggcgttccccgtgaggacggcttcaatatcacccca
gcctcagagattatggcaatcctctgcttggcggagagcttttccgacctcaagcgccgc
ttgggcaatatatatataggtaaaaagtttgacggcacgcctgtttttgcccgcgatctg
aaagccgtcggagcgatggcactgctgctgaaggacgctatcaagccgaacctcgtccag
accctcgagaataatcctgcgatcatccacggcggtcctttcgccagcatcgcgcagggc
accaattccgtcttagcaaccaagctcgggctctcgttggctgactatacagtcaccgaa
gccggcttcggcgcggatttaggtgctgaaaagttcttcgacatcaagtgcacttctgca
ggattggcgcccgacgcggtagtgatcgtcgccacagtgcgcgctttgcggcatcacggt
ggcgccaaaaaggacgagtacaatacccccagcaccgagcgcgtcgcccttggattgccc
aatttggagaagcacatcgagaatatacagcttttcggggtagaatgtgtggtagccatc
aacgctttcccaagcgatacgcccgaggaggttgcgcttatcgaacaatgctgcgccgcc
aagggagttcgcgctatcgtatcgcgcggcttcgctgaagggggcaagggtacccaagcg
ctggcagaggcggtggtagccttagctgagaatggtaagagtcatttccgcccgctctac
cgcaatgaggattctatcgaggataaaatcagctgcatcgccaccaaaatttacggtgcc
agcggcgtggtttacagcagtaaagcgcagaaggaactcaaagaaatcaaaaagctcggc
ttcgacacactgccagtttgtatggtgaagacgccgaagtcactcagcgacgacgagaag
aagctgtcacgccctcgccagttcgaaatcacggtgcgcgagttcgaatttgcctcaggc
gcgggttttgtcatcccgatactcggcgatacgatgcggatgccaggcttgccaagtgtg
cctgccgcagaagcaatggatatcgacgacaacggggtaatcactggtttatcataa

DBGET integrated database retrieval system