KEGG   Chryseobacterium sp. IHB B 10212: A0O34_00995Help
Entry
A0O34_00995       CDS       T04575                                 

Definition
(GenBank) coproporphyrinogen III oxidase
  KO
K02495  oxygen-independent coproporphyrinogen III oxidase [EC:1.3.98.3]
Organism
chh  Chryseobacterium sp. IHB B 10212
Pathway
chh00860  Porphyrin and chlorophyll metabolism
chh01100  Metabolic pathways
chh01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:chh00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    A0O34_00995
Enzymes [BR:chh01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.98  With other, known, physiological acceptors
    1.3.98.3  coproporphyrinogen dehydrogenase
     A0O34_00995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM HemN_C HTH_45 Fer4_14
Motif
Other DBs
NCBI-ProteinID: ANF49218
UniProt: A0A172XQE6
Position
complement(226629..227987)
Genome map
AA seq 452 aa AA seqDB search
MNSLIDKYNIPGPRYTSYPTVPYWDESTFSPEKWKESVIRSFKESNAAEGISIYIHLPFC
EALCTFCACHKRITKQHSVETPYLESVLKEWKLYLELFNEKPKLKELHLGGGTPTFFSPK
NLKTLLEGIFESVEIAEHPEFSFEGHPNNTTKDHLQTLYDLGFRRVSFGVQDYDPKVQKA
INRIQPFENVKNVTEWAKEIGYRGISHDLVFGLPHQSWEAMEHTIRKTMELKPDRLAFYS
YAHVPWVKGVGQRGFDENDLPSGEEKRRLYEDGKKLLEDLGYIEVGMDHFSLEHDDLYQS
LIQKKLHRNFMGYTSSNTQLMVGLGMSSISDSWYAFAQNVKTVEEYQKTVEEGEIPVVKG
HILNEEDLIVRRHILNLMCQLETTFDAQNSFPELENAFEMLKEMEKDELVEIHDNQIKIT
EKGRAFTRNVAMVFDLRMMRNKPETRIFSMTI
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgaattctttaatagataaatataatattccgggacctcgttacacgtcttatcctact
gttccttattgggatgagagtactttttcacctgaaaaatggaaggaaagtgtaataagg
tcatttaaggaaagtaatgcagcggaaggaatttctatttacatccatttgcctttttgt
gaggctttgtgtacattttgcgcgtgccacaagcgtattacaaaacagcatagtgtagaa
acaccttatttagaaagtgttttaaaagaatggaagctttatctggaactttttaatgaa
aaaccaaaattaaaagaacttcatttaggcggaggaacaccgacatttttctctcctaaa
aatttaaaaactttattggaaggtatctttgaaagcgtggaaattgcagaacatcctgag
ttttctttcgaaggtcacccaaataatacaacgaaagatcatcttcagactttatatgat
ttaggtttcagaagagtgagttttggagttcaggattatgatcctaaagttcagaaagcg
atcaacagaattcagccttttgaaaatgtgaaaaatgtgacagaatgggctaaagagatt
ggctacagagggatcagtcacgatctggttttcggacttccacatcagagttgggaagca
atggaacatacaattcgtaaaacaatggaattaaagcctgacagacttgctttttattct
tacgcacacgttccatgggtgaaaggtgttggacaaagaggtttcgacgaaaatgatctc
ccaagcggagaagaaaaacgccgtttatatgaagatggtaagaaattattggaagatcta
ggatatattgaagtgggaatggatcatttttctcttgaacatgatgatctgtaccaatca
ttgattcagaaaaagcttcacagaaacttcatgggatatacttcgagcaatactcaattg
atggttggtcttggaatgtcttctatttctgattcttggtatgcttttgctcagaatgta
aaaactgtggaagagtatcagaagacggttgaagaaggcgaaattccggtggtaaaaggg
catatcttaaatgaagaagatttgattgtaagaaggcatattttgaatttaatgtgtcag
cttgaaacaactttcgatgctcaaaactctttccctgagctggaaaatgcttttgaaatg
cttaaagaaatggaaaaagatgagttggttgaaattcatgataatcagataaaaattacc
gaaaaaggacgagcatttacaagaaacgttgcgatggtttttgaccttagaatgatgaga
aataaacctgagactagaattttctcaatgacgatctag

DBGET integrated database retrieval system