KEGG   Chryseobacterium sp. IHB B 10212: A0O34_05505Help
Entry
A0O34_05505       CDS       T04575                                 

Definition
(GenBank) NAD(P)H-dependent oxidoreductase
  KO
K10679  nitroreductase / dihydropteridine reductase [EC:1.-.-.- 1.5.1.34]
Organism
chh  Chryseobacterium sp. IHB B 10212
Pathway
chh00633  Nitrotoluene degradation
chh01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:chh00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    A0O34_05505
Enzymes [BR:chh01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.34  6,7-dihydropteridine reductase
     A0O34_05505
  1.-  
   1.-.-  
    1.-.-.-  
     A0O34_05505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Nitroreductase TM1586_NiRdase
Motif
Other DBs
NCBI-ProteinID: ANF50014
UniProt: A0A172XSU9
Position
1244168..1244767
Genome map
AA seq 199 aa AA seqDB search
MNFLNKMKTRYTVKKYNPQGIISEEQIAQLKEILHLSPSSINSQPWNFVFVNNLEIKTEL
AEASYFNKEKIVDSNQLVVFQVIKNVKDFEEQIEENLPEGSINYYKNFVKPKGEEAIKSW
LGHQVYLSLGVFLSACADMGIDSTPMEGIETDKYNEILKNEAYETLFAVVIGEKSEEDSN
QPSHTPKKRLESKKVILEI
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgaactttttaaacaaaatgaaaacgaggtataccgtaaaaaaatacaatcctcaagga
ataataagtgaagaacaaatagctcaattgaaagaaattttacatctcagtccatcttcc
atcaacagccagccatggaattttgtgtttgtaaataatcttgaaatcaaaactgaattg
gcagaagcttcttattttaacaaagagaaaattgtagacagcaatcaattagttgtattt
caggtgatcaaaaacgttaaagattttgaagagcagattgaggaaaatcttcccgaaggt
tctattaattattacaaaaactttgtaaaaccaaaaggtgaagaagccataaaatcatgg
cttggacatcaggtttatctgtctctgggagtttttctttctgcttgtgctgatatggga
attgattccacaccgatggaaggaattgaaacagataaatacaacgagattttgaaaaat
gaagcctatgaaactttgtttgcagtagtaatcggtgagaaatccgaagaagacagcaat
cagccgagccatactccgaaaaagagattggaaagtaaaaaggtgattttggaaatttaa

DBGET integrated database retrieval system