KEGG   Chryseobacterium sp. IHB B 10212: A0O34_07595Help
Entry
A0O34_07595       CDS       T04575                                 

Definition
(GenBank) phosphoenolpyruvate carboxykinase (ATP)
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
chh  Chryseobacterium sp. IHB B 10212
Pathway
chh00010  Glycolysis / Gluconeogenesis
chh00020  Citrate cycle (TCA cycle)
chh00620  Pyruvate metabolism
chh01100  Metabolic pathways
chh01110  Biosynthesis of secondary metabolites
chh01120  Microbial metabolism in diverse environments
chh01130  Biosynthesis of antibiotics
chh01200  Carbon metabolism
Module
chh_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:chh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A0O34_07595
   00020 Citrate cycle (TCA cycle)
    A0O34_07595
   00620 Pyruvate metabolism
    A0O34_07595
Enzymes [BR:chh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     A0O34_07595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP AAA_33
Motif
Other DBs
NCBI-ProteinID: ANF50386
UniProt: A0A172XTZ6
Position
complement(1703520..1705139)
Genome map
AA seq 539 aa AA seqDB search
MKHAKIIQDLEKLGIKGDYEIQYNPSYEELYQAEISPENQGFEKAELTESGAVSVKTGIF
TGRSPKDRYIVQDDVTKDTIFWDGKVNLPTSPEIFQSCKELVLNQLSTSKKIYVVDAFCG
TNADTRLKVRFIVEVAWQAHFVTNMFIRPSHYELENFGEPDFTVINGSKTTNPNWEAQGL
NSENFVMFNLTEKLQIIGGTWYGGEMKKGMFAMMNYYLPLKGMASMHCSANVGEEGDVAL
FFGLSGTGKTTLSADPKRYLIGDDEHGWDNNGVFNYEGGCYAKVIDLSEEKEPDIFRAIK
RDALLENVVVNTGVSDYTDGSITENTRVSYPIYHINKIVLPSKAGHASKIVYLSADAFGV
LPPVSVLDENQAQYHFLCGYTSKLAGTERGITEPEPSFSPAFGEAFLTLHPTMYSKTLIG
KMKEHGAKAYLVNTGWNGTGKRISLKDTRAIIDAIIDGSIENAPKTRIPIMNLEIPTELP
NVSEGILDPRNTYNEVTEWEEKAKDLAAKYIKNFDQYCNTEEGKKLIASGPQLQQQTIN
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgaaacacgctaaaatcatccaagatttagaaaaattagggattaaaggagactatgaa
attcaatataatccttcttatgaagagttgtatcaagcagaaatttctcctgaaaatcaa
ggctttgagaaagctgagcttacggaatctggtgcggtatcagtaaaaacaggaattttc
acaggtcgttctcctaaagatagatacattgtacaggatgatgttacaaaagacacgatt
ttctgggatggtaaagttaacttaccgacttctccggaaattttccagtcttgtaaggaa
ttagtgttgaaccaactttcaacttctaagaaaatttatgttgtagatgctttctgtgga
acgaatgcagatacaagacttaaagtaagattcattgtagaggttgcatggcaggcgcat
ttcgttactaatatgttcatccgtccttctcactatgagttggaaaacttcggagagcct
gatttcacagtaatcaacggttctaaaactacaaatccgaactgggaagctcaaggatta
aattctgaaaacttcgtgatgttcaaccttactgaaaagcttcaaattattggaggaact
tggtacggtggagaaatgaaaaaaggaatgtttgccatgatgaactattaccttccattg
aaaggaatggcttctatgcactgttctgcaaacgtaggtgaagagggagatgttgctctt
ttcttcggactttcaggaacaggaaaaactactttatctgcagatccgaaaagatatttg
atcggtgatgacgagcacggttgggataataacggcgtatttaactatgaaggtggttgt
tatgcaaaagtaatcgacctttctgaagaaaaagaaccggatattttcagagccatcaaa
agagatgcacttcttgaaaatgttgtggtaaacaccggagtatctgattatactgacgga
tcaatcactgaaaacacaagagtttcttatccgatttatcatattaataaaattgttttg
ccttcaaaagcaggacatgcaagcaagattgtttacctttctgctgatgcgttcggagta
ttacctccggtttctgttttggatgaaaaccaagctcaataccacttcctttgcggttat
acttcaaaattagccggaactgaaagaggaattactgaaccggaaccatctttctctcca
gcatttggtgaagcgttcttaacattacacccaacaatgtattctaaaacattgatcggt
aaaatgaaagaacacggagcaaaagcatacttagttaatacgggttggaacggtactgga
aagagaatctctttaaaagatacaagagcgattattgatgcaatcattgatggatctatc
gaaaatgctcctaaaactagaattccaataatgaatttggagattcctactgaattacca
aacgtttctgaaggtattttagatccaagaaatacatacaacgaagttactgagtgggaa
gaaaaagcaaaagatcttgctgcaaaatatatcaaaaactttgatcagtattgtaataca
gaagaagggaaaaagcttatcgcttccggacctcaattacaacaacagacaataaactaa

DBGET integrated database retrieval system