KEGG   Chryseobacterium glaciei: A0O34_19665Help
Entry
A0O34_19665       CDS       T04575                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
chh  Chryseobacterium glaciei
Pathway
chh00010  Glycolysis / Gluconeogenesis
chh00053  Ascorbate and aldarate metabolism
chh00071  Fatty acid degradation
chh00280  Valine, leucine and isoleucine degradation
chh00310  Lysine degradation
chh00330  Arginine and proline metabolism
chh00340  Histidine metabolism
chh00380  Tryptophan metabolism
chh00410  beta-Alanine metabolism
chh00561  Glycerolipid metabolism
chh00620  Pyruvate metabolism
chh00625  Chloroalkane and chloroalkene degradation
chh01100  Metabolic pathways
chh01110  Biosynthesis of secondary metabolites
chh01120  Microbial metabolism in diverse environments
chh01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:chh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A0O34_19665
   00053 Ascorbate and aldarate metabolism
    A0O34_19665
   00620 Pyruvate metabolism
    A0O34_19665
  09103 Lipid metabolism
   00071 Fatty acid degradation
    A0O34_19665
   00561 Glycerolipid metabolism
    A0O34_19665
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    A0O34_19665
   00310 Lysine degradation
    A0O34_19665
   00330 Arginine and proline metabolism
    A0O34_19665
   00340 Histidine metabolism
    A0O34_19665
   00380 Tryptophan metabolism
    A0O34_19665
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    A0O34_19665
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    A0O34_19665
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    A0O34_19665
Enzymes [BR:chh01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     A0O34_19665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC YacG
Motif
Other DBs
NCBI-ProteinID: ANF52594
UniProt: A0A172Y054
Position
complement(4350947..4352497)
Genome map
AA seq 516 aa AA seqDB search
MSKKVKDFGIEKTLKNLGIKDENKGTSIGGKYFASGKTIESYSPADGRLIGKIKTSGESD
YDKVIESAQKAFLEFRMIPAPRRGELVRQLGLKLREYKDDLGKLVSYEMGKSLQEGLGEV
QEMIDICDFAVGLSRQLHGYTMHSERPGHRMYEQYHPLGIVSIITAFNFPVAVWAWNTAL
SWICGNVTIWKPSEKTPFCAIACQNIMAEVLKENNISEGVSSLLVSDHEIGQKLVEDKRV
SLVSFTGSTRVGRMVSTKVAERFGKSILELGGNNAIIISKDADIDMSIIGAVFGAVGTAG
QRCTSTRRLIIHEDVYEEIKKRLVKAYGQLKIGNPLDENNHVGPLIDVDAVNQYEESIKK
CKKEGGKFIVEGGVLEGKDYESGCYVKPCIAEVKNSFEIVQHETFAPILYLIKYKTLDEA
IAIQNDVPQGLSSAIMTQNLREAELFLSQAGSDCGIANVNIGTSGAEIGGAFGGEKETGG
GRESGSDVWKYYMRRQTNTINYTAELPLAQGIKFDL
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaaaaagtcaaagatttcgggatcgaaaaaacactcaaaaatctaggtattaaa
gatgaaaataaaggaacttccataggtggaaaatactttgcttcaggcaaaacgattgaa
agttattctcctgctgatggaagattgattggtaaaataaaaacttccggagagagcgat
tatgataaagtaatagaatctgctcaaaaggcatttttggaattcagaatgattccggct
ccaagaagaggcgaattagtaagacagttaggattaaaactaagagaatataaggatgat
ttaggtaaacttgtttcttatgaaatgggtaaatctttgcaggaaggtctaggtgaagtt
caggaaatgatcgatatctgcgactttgcagttggtttatcaagacagcttcacgggtac
acaatgcattctgaaagacctggtcacagaatgtacgagcaatatcatccgcttggaatt
gtaagtatcatcacagctttcaactttccggtagcagtttgggcttggaatacagcttta
tcatggatctgtggtaacgttacgatctggaaaccatcagaaaaaacacctttctgtgcg
atagcttgtcaaaacattatggctgaagttcttaaagagaacaatatttcagaaggagtt
tcaagtttattggtttctgatcatgagatcggacaaaaattagtggaagacaaaagagtt
tctctggtttctttcacaggttctacaagagtcggaagaatggtttctactaaagtggca
gaaagattcgggaaatctatccttgaattaggcggaaataacgccatcattatatctaaa
gatgcagatatcgacatgtcgatcatcggagctgtttttggagctgtaggaacggctgga
caaagatgtacaagtacaagaagactaatcattcacgaagatgtgtatgaagaaattaag
aaaagattggttaaagcttatggtcagttaaaaattggaaatccattggatgaaaataat
cacgttggaccgcttatcgatgttgatgcagtaaatcagtacgaagaatcaatcaaaaaa
tgtaaaaaagaaggtggaaaattcatcgttgaaggtggagttttggaaggaaaagattac
gaatctggatgttatgtaaaaccatgtatcgctgaagtaaaaaattctttcgaaatcgta
caacacgaaacttttgcaccgattttatatttaattaaatacaaaacattggacgaggcg
attgctattcagaatgatgttcctcaaggtttatcttctgcgatcatgactcaaaacttg
agagaagcagaattattcctttctcaggcaggttcagactgtggaattgctaacgtaaac
atcggaacttccggtgctgaaatcggtggtgctttcggtggtgaaaaagaaacaggaggc
ggtagagaatctggttctgatgtttggaaatactacatgagaagacaaactaacactata
aattacacagcagaacttcctttagcacaaggtattaaattcgacttgtaa

DBGET integrated database retrieval system