KEGG   Cardiobacterium hominis: NCTC10426_00145Help
Entry
NCTC10426_00145   CDS       T05791                                 

Gene name
recB
Definition
(GenBank) Exodeoxyribonuclease V beta chain
  KO
K03582  exodeoxyribonuclease V beta subunit [EC:3.1.11.5]
Organism
chj  Cardiobacterium hominis
Pathway
chj03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:chj00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    NCTC10426_00145 (recB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:chj03400]
    NCTC10426_00145 (recB)
Enzymes [BR:chj01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     NCTC10426_00145 (recB)
DNA repair and recombination proteins [BR:chj03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     NCTC10426_00145 (recB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UvrD-helicase UvrD_C AAA_19 UvrD_C_2 PDDEXK_1 AAA_30 AAA_22 ResIII AAA_25 DUF3764
Motif
Other DBs
NCBI-ProteinID: VEG76134
Position
1:complement(167332..171195)
Genome map
AA seq 1287 aa AA seqDB search
MNTTTEPTPALEIPLEGRALIEASAGTGKTWTLTGIILRLLIEGGYPPREIIATTFTRKA
AAEMQQRVHKRLHALRENLKAIAARYLAEETVLNDDDGLATRLDDIIGGSGGDLINRHLI
LNAVAKHGLDGLIAIFSRVESLQARLDELFIGTIDSLCQRWLAEFALETGNDERLQINEN
SPALEETIHDTLRRLLHENHQHDPETFAQMLADGAYHDSDAYLAAAREATSHRHAAIDSG
DVSADYSRDRHQALTRQLRELDAAVIADWQAMIDAPEFAAAVAKNAAWYKQRDALPQLLQ
QLHQELPFNDRTEALASGFGKPRISSKQTALTAAFTAHPFTLLIRDLLAARDARQNHLDH
HKRQTIASLLETVRQTYPQALEARGETTFSEKTARINEALAHPQHGTNLAHYLTRRYPVM
LVDESQDLNDEQAALLERTYLREDGERKHGFLLLVGDPKQAIYGFRGGDVANYNRLKTRF
RPDEQHRLDTNRRSSPNLIAALNEHYLQDDNARLGTDITYHEAQAANPAQTILAADGSPI
ARPMQWTHSGTNQDSETDTIAALVARLTDGTGIAPRDIQILMRSNSSLETLQNKLHAQHI
DSERSHDRSVFTGAVARTFADLLAALEQPEHRDRQNRLLSGLYYGYSQQDLDRLAAIEQG
EIPARADELTLAELREALTQAHDAWQSWGLLAALNPLLTHEKHNIWQTLASCPAPDNLRH
LLDLRHIQTILAEHAPKQRPAQFGAWWRAQLAAPPDADWAKAPPLPGQNAVHLLTIHKAK
GLEAPVVILATGSNHKGGGANPVPTWRYRDGDTIRISLAKPANTPIDQQENEEQRRLLYV
GLTRAKNLLLVAHRECKPDKANPTPTEKLYLTYAQNPGRCPHAGETSAEALAALPYRAHP
SHEPPANPPPPQSGGGEGGNGGSACDFTAYAHEKPLSLWERGWGEGGEKAASAGRISAQR
VTQQPDDHQTAATEPPTNPPPQQSGGGQGRGCENPRSTAPVWRTRFQGWQRSSFSALLRD
AIEPTSPDLADYAVATPQNAPDAPPDADIRYTYPRGTAPGSALHAVLERIRPDNRRDWRR
YLEHDNRQWQLGLEPAQLDACENWLEAIQYCELPQSRISLGTSKQGAHRSEYGFTLGSDA
RVALDIPAINAHFAAHGHPLHLSDKHRHIRYLRGEIDHLYQHDGRYYILDYKTNHLGNSP
ADYTPENIRAAMGDHHYWLQAALYQVALHRLLQTRLADYDPARHLGGIEYLYLRGIDPAH
PANGKYGWNYPPEFIAGLDRILGHEAA
NT seq 3864 nt NT seq  +upstreamnt  +downstreamnt
atgaacaccacgaccgaacccacccccgctctggaaatcccgctcgaaggccgcgccctc
atcgaagcctccgccggtaccggcaaaacctggacgctcaccggcatcatcctgcgcctg
ctcatcgaaggcggctacccgccgcgcgaaatcatcgccaccaccttcacccgcaaggcg
gcggcggaaatgcagcagcgcgtgcacaagcgcctgcacgctctgcgcgaaaacctgaaa
gccatcgccgcgcgctatcttgccgaagaaacggtgctgaatgatgacgacggcctcgcg
acccgcctggacgacatcatcggcggcagcggcggcgacctcatcaaccgccacctcatc
ctgaacgcggtcgcaaagcatgggctggacggcctcatcgccattttcagccgcgtcgaa
agcctgcaagcgcggctggacgagctgttcatcggcaccatcgacagcctctgccagcgc
tggctggcggaatttgcgctggaaacgggcaacgacgaacgcctgcaaatcaacgaaaac
agcccggcgctggaagaaaccatccacgacaccctgcgccgcctcctgcacgaaaaccac
cagcacgacccggaaaccttcgcgcaaatgctggcggacggcgcgtatcacgacagcgac
gcctacctcgccgccgcgcgcgaggcgaccagccaccgccatgccgcaatcgacagcggc
gacgtctctgccgactacagccgcgaccgccatcaagcgctcacgcggcagttgcgcgaa
cttgatgcggcggtgattgccgactggcaggccatgattgacgccccggaatttgccgcc
gccgttgccaaaaacgccgcctggtacaaacagcgcgatgcgctgccgcaactgctgcaa
caactgcatcaagaactgccatttaacgaccgcaccgaagccctcgccagcggctttggt
aaaccccgcatcagcagcaaacaaaccgcgcttaccgcagccttcaccgcccaccccttc
accctcctcatccgcgacctcctcgccgcgcgcgacgcccgacaaaaccacctcgaccac
cacaaacgccaaaccatcgccagcctcctcgaaaccgtgcgccaaacctacccgcaggcg
ctggaagcgcgcggcgaaaccaccttcagcgaaaaaaccgcacgcatcaacgaagccctt
gcccacccgcaacacggcaccaacctcgcgcactacctcacccgccgttaccccgtcatg
ctcgtggacgaatcccaggatctgaacgacgaacaggccgccctgctcgagcgcacctac
ctgcgggaagacggcgagcgcaaacacggcttccttctcctcgtcggcgacccgaaacag
gcgatatacggcttccgcggcggcgacgtcgccaactacaaccgcctcaaaacccgcttc
cgacccgacgaacaacaccgcctcgacaccaaccgccgcagcagccccaacctcatcgcc
gcgctgaacgaacactacctgcaagacgacaatgcccgcctcggcacggacatcacctac
cacgaagcccaagcggccaaccccgcacaaaccatcctcgccgccgacggcagccccatc
gcgcgcccgatgcaatggacgcacagcggcaccaaccaggacagcgaaaccgacaccatc
gccgccctcgtcgcccgcctcacggatggcaccggcatcgcgccgcgcgacatccaaatc
ctcatgcgcagcaacagcagcctcgaaaccctgcaaaacaaactgcacgcacaacacatc
gacagcgagcgcagccacgaccgcagcgtcttcaccggcgccgtcgcccgcaccttcgcc
gacctcctcgccgccctcgaacaacccgaacaccgcgaccgccagaaccgcctgctaagc
ggcctctactacggctacagccaacaagacctcgaccgtctcgccgccatcgaacaaggc
gaaatccccgcgcgcgcggacgaactcaccctggccgaactgcgcgaagcgctcacccag
gcgcacgatgcctggcaaagctggggactgcttgccgccctcaacccgctactcacccac
gaaaaacacaacatctggcaaaccctcgcctcctgccccgcgccggacaacctgcgccac
ctcctcgacctgcgccacatccagaccatcctcgccgaacacgcgcccaaacagcgcccg
gcacaatttggcgcctggtggcgcgcccagctcgccgccccgccggatgccgactgggct
aaagccccgccactgccgggacaaaacgccgtccacctgctcaccatccacaaagccaaa
ggcctcgaagcgcccgtcgtcatcctcgccaccggcagcaaccacaaaggcggcggcgcc
aaccccgtgccgacctggcgttaccgcgacggcgacaccatccgcatcagcctcgccaaa
cccgcaaacacccccattgaccaacaagaaaacgaagaacagcgccgcctgctctacgtc
ggcctcacccgcgccaaaaacctgctcctcgttgcccaccgcgaatgcaaaccggacaaa
gccaacccgaccccgaccgaaaaactctacctgacctacgcgcaaaaccccggacgttgc
ccgcacgcgggcgaaaccagcgccgaagcccttgccgccctcccataccgcgcgcaccca
tcccacgaaccacccgccaatcccccgcccccgcaaagcgggggcggggagggcgggaac
ggaggtagtgcatgcgatttcactgcctatgcgcacgaaaagcccctctccctttgggag
agggggtggggtgagggcggtgaaaaagctgcttccgcagggcggattagcgcgcagcgc
gtaacccaacaaccggatgaccatcaaaccgccgctaccgaaccacccaccaatcccccg
ccccagcaaagcgggggagggcaggggagggggtgtgaaaacccgcgcagcaccgccccg
gtctggcgcacccgcttccagggctggcaacgcagcagcttcagcgccctcctgcgcgac
gccatcgaacccacctcgcccgaccttgctgactacgccgtcgccacaccccaaaacgcg
cccgacgccccgccggatgccgacatccgctacacctacccacgcggcaccgcgcccggc
agcgccctgcacgccgtgctggagcgcatccgcccggacaaccgtcgcgactggcgccgc
tacctcgaacacgacaaccgccaatggcaactcggtctcgaacccgctcaactggacgcc
tgcgaaaactggctggaagccatccagtactgcgaactgccgcaaagccgtatcagcctc
ggcacgagcaaacaaggcgcgcaccgcagcgaatacggcttcaccctcggcagcgacgcc
cgtgtcgccctcgacatccccgccatcaacgcccactttgccgcgcacggccacccgctc
cacctcagcgacaaacaccgccatatccgctacctccgtggcgaaatcgaccacctctac
cagcacgacggccgctactacatcctcgactacaaaactaaccacctcggcaacagcccc
gccgactacacgccggaaaacatccgcgcagcgatgggcgaccaccactactggctgcaa
gccgcgctctaccaagtagcgctgcaccgcctgctgcaaacccgccttgcggactacgac
cccgcgcgccacctcggcggcatcgaatacctctacctgcgcggtatcgaccccgcccat
ccggcaaacggcaaatacggctggaactacccgccggaattcatcgccggacttgaccgc
atcctcggccacgaagccgcctga

DBGET integrated database retrieval system