KEGG   Chryseolinea sp. KIS68-18: D4L85_06780Help
Entry
D4L85_06780       CDS       T05641                                 

Definition
(GenBank) phosphatidylserine decarboxylase family protein
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
chk  Chryseolinea sp. KIS68-18
Pathway
chk00564  Glycerophospholipid metabolism
chk01100  Metabolic pathways
chk01110  Biosynthesis of secondary metabolites
Module
chk_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:chk00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    D4L85_06780
Enzymes [BR:chk01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     D4L85_06780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase PTS_EIIA_1
Motif
Other DBs
NCBI-ProteinID: AYB30312
UniProt: A0A385SHE8
Position
1598844..1599503
Genome map
AA seq 219 aa AA seqDB search
MTIHREGRTLLFVLLLILFALNWAVAYYMPGNAAVQNTVIGVSIIFYLIILQFFRIPLFK
VQQNENQVLAPADGKVVVIEETEETEYLKGRRKQVSIFMSPVNVHINRMPVGGIISYFAY
HPGKYLVAWHPKSSTENERTTVVVKMKDGVEILFRQIAGALARRIKWYVKQDQQLQQGDE
FGFIKFGSRVDIYLPLDAKVTVKIGDVTKGGKTVLAELK
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgacgatacaccgcgaaggccgtactttactttttgtcctcttgttgattcttttcgcc
ctgaattgggcagtggcctactacatgcccggcaacgcggcggtgcaaaacacagtgatc
ggcgtcagcattatcttctatctcatcatccttcagttcttccgcatccccctcttcaag
gtacagcagaacgaaaaccaagtgctggcaccggccgacggcaaagtggtggtgatcgaa
gagaccgaggagaccgaatatctgaaaggcaggagaaagcaggtgtccattttcatgtcg
ccggtgaacgtgcacatcaatcgcatgcccgtgggcggcatcatcagctattttgcctac
catcccggcaaatacctcgtggcctggcaccccaaatccagcacggaaaacgaacggacc
accgtggtagtgaaaatgaaagacggcgtggagatcctcttccgccagatcgccggcgca
ctcgcccgccgcatcaagtggtatgtgaaacaagatcagcagctgcagcagggcgacgaa
ttcgggttcatcaaattcggctcccgcgtcgacatttatcttccgttggacgcaaaggtc
acggtgaagatcggcgatgttacaaagggtggcaagacggtgctggccgagctaaaataa

DBGET integrated database retrieval system