KEGG   Chryseolinea sp. KIS68-18: D4L85_10105Help
Entry
D4L85_10105       CDS       T05641                                 

Definition
(GenBank) phospholipase C, phosphocholine-specific
  KO
K01114  phospholipase C [EC:3.1.4.3]
Organism
chk  Chryseolinea sp. KIS68-18
Pathway
chk00562  Inositol phosphate metabolism
chk00564  Glycerophospholipid metabolism
chk01100  Metabolic pathways
chk01110  Biosynthesis of secondary metabolites
chk02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:chk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    D4L85_10105
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    D4L85_10105
   00565 Ether lipid metabolism
    D4L85_10105
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    D4L85_10105
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:chk02042]
    D4L85_10105
Enzymes [BR:chk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.3  phospholipase C
     D4L85_10105
Bacterial toxins [BR:chk02042]
 Type II toxins: Membrane damaging toxins
  Toxins that enzymatically damage the membrane
   D4L85_10105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphoesterase DUF756 DUF2716
Motif
Other DBs
NCBI-ProteinID: AYB30909
UniProt: A0A385SI62
Position
2325938..2328451
Genome map
AA seq 837 aa AA seqDB search
MESRRDFLKKAALLSGMGGVYSSIPASVARAFAIDPAVGTTYLDAEHVVILMQENRSFDH
CYGSLSGVRGFNDPRFVTLPDKKPVWMQTNEKNETYVPFRLNIKETKATWMGSLPHGWTD
QVDVRNGGACDQWLKAKKSGHPEYRQMPLTLGFYSREDIPFYYSLADAFTVCDQNFCSSL
TGTTPNRLHLWTGKVHEDAMKPARIRNEETDYDAEAQWKTFPERLEENGVSWKIYQNELS
VGVGFEGDEDDWLSNFTDNPIEWFSQFHVKFHPAYIKYLPKKIEWLKSEIAKGKAKLATL
TAGTDDHTKLKRSLERGEEELEISRQDVTVYTMDNWNKLSQHEKDIHHKAFTTNINDPDY
HTLETVTYNDNGTTREMKVPKGDVLFQFRKDVNEGKLPAVSWLVAPSNFSDHPGSPWYGA
WYLSESIDILTKNPEVWKKTIFILCYDENDGYFDHVPPFVPPVPGQPSTGKVSASIDTAM
EHLSLDMDLKRKPANQARGSAVGLGYRVPLVIASPWSRGGAVNSQVCDHTSILMFLEKFL
TKKTGKRIEESNISSWRRAVCGDLTSVFAPYNGEPVALPDFVEKKPFYESIHKAQFKDVP
VMPPPVTTNEIERALASGTFPAAMPVQESGMRKSNALPYELYVTGGVSADQKSFRFVFNA
GKGVFGERSSGAPFIVYAFANEWATRSYAVAPGESVTDEWSLDAFPNGRYHFRVDGPNGF
MREFSGSLGAGDQVTVEAPYEKGTGKNLTGNLLLTVNNRQAKSVTVEVVDEAYGQKSLKK
EIAKNAAYTFKGDLTKSFGWYDTSVRITATDFEVRLAGRVETGKESKSDPAMNKQGA
NT seq 2514 nt NT seq  +upstreamnt  +downstreamnt
atggaatcaagaagagactttttgaagaaggcggcgctgctctcgggtatgggaggcgtg
tacagtagtatccccgcatccgtggcgcgcgcatttgccatcgaccccgccgtgggcaca
acctatctggacgccgaacacgttgtcattctgatgcaggagaaccgatcgtttgatcat
tgctatggctccctcagcggagtgcggggatttaatgatccccgctttgtgacgcttccc
gacaaaaagccggtctggatgcagaccaatgaaaaaaatgaaacctatgttccgttccgt
ctcaacatcaaagagacgaaggccacgtggatgggttcgctgccgcacggctggaccgat
caagttgacgtgcgcaatggtggagcctgcgaccaatggctgaaagcgaaaaagtcaggt
cacccggaatatcgacagatgccgctcacacttgggttctatagccgtgaagacattcct
ttttattattcactggcggatgccttcacggtttgcgatcagaatttctgttcgtcgctg
accggcaccacgccaaaccggcttcacctgtggacgggcaaagtccacgaagatgcaatg
aagcctgcccgcatccggaacgaggaaaccgactacgacgccgaagcccagtggaaaact
tttcccgaacggttggaggaaaacggcgtctcctggaagatctatcagaatgagctgagc
gttggggtgggttttgagggtgacgaggatgactggctgtctaattttacggacaatcct
attgaatggttctcgcagttccatgtcaaatttcaccccgcgtatatcaaatacctcccg
aaaaagatagagtggctgaagtctgaaattgcaaaaggaaaagcgaagctggcgaccctt
accgcaggaactgatgatcatacaaaattgaagcgaagtctcgagcggggtgaagaagaa
cttgagatctcacgccaggatgtgaccgtctatacgatggataactggaacaagctgtca
cagcacgagaaggatatccaccacaaggctttcaccaccaatatcaacgatcctgattat
catacgttggaaaccgtcacctacaacgacaacggcacaacgcgcgaaatgaaagttccc
aagggcgatgtgctttttcaattccgcaaggacgtgaacgaaggcaagctccccgccgtg
tcgtggctggtggcgccttctaatttttcggatcacccggggtcgccctggtacggtgcc
tggtatttgtccgaatcgatcgacattcttacgaagaatccggaggtgtggaaaaagacc
atcttcattctttgctacgatgagaacgacggctacttcgatcacgtaccaccttttgtt
ccgccggtgccgggccaaccctcgaccggtaaagtatccgcatcgatcgacacggcgatg
gagcatttgtcgctcgacatggatctgaaacgcaagcccgccaaccaggcgcgcggaagt
gctgtcggtctcgggtaccgcgttccattggttattgcttccccttggagtcggggtggt
gccgtgaattcgcaggtatgcgatcatacttccatcctcatgtttcttgaaaagtttctc
acaaaaaaaacaggtaagcggatcgaagaatcaaacatcagctcctggcgccgcgccgtg
tgtggcgatcttacttccgtctttgctccttacaacggcgagcctgttgcgctgcctgat
tttgtggagaagaagccgttctatgaatccattcacaaggcgcagttcaaagatgttcca
gtgatgccgccgccggtgacgacgaatgagattgaacgggccctggcgtccggtacattt
cccgcggcgatgccggtgcaggagagcggtatgcgaaaatcgaatgcacttccctatgaa
ctttatgtgacgggcggggtgagtgcagaccaaaaatcttttcggtttgtatttaacgcg
ggtaagggtgtgtttggggaaagatcttccggggcgccgttcatcgtgtatgcttttgct
aacgagtgggccacacggtcgtatgccgtcgcgcccggcgaatcggttacggacgaatgg
tctctcgatgctttccccaatggacgctatcatttccgcgtagatggcccgaatggattt
atgcgcgagttcagcggcagcctgggagccggcgatcaggtaacggtggaggccccctat
gaaaaaggaactggaaaaaatctcaccggcaatttgctgctcaccgtaaacaaccgacag
gcaaaatccgtgacggtcgaggtcgttgacgaggcttacggtcagaagagcctgaagaag
gagattgccaagaatgctgcctatacattcaaaggtgatctgaccaagagctttggctgg
tacgacacgtcggtccgcatcacagcaactgatttcgaagtgcgcctggcaggacgagtg
gagaccggcaaagaaagcaagtccgatccagcgatgaataagcaaggagcgtga

DBGET integrated database retrieval system