KEGG   Chryseolinea sp. KIS68-18: D4L85_12260Help
Entry
D4L85_12260       CDS       T05641                                 

Gene name
metX
Definition
(GenBank) homoserine O-acetyltransferase
  KO
K00641  homoserine O-acetyltransferase/O-succinyltransferase [EC:2.3.1.31 2.3.1.46]
Organism
chk  Chryseolinea sp. KIS68-18
Pathway
chk00270  Cysteine and methionine metabolism
chk00920  Sulfur metabolism
chk01100  Metabolic pathways
chk01110  Biosynthesis of secondary metabolites
chk01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:chk00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    D4L85_12260 (metX)
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    D4L85_12260 (metX)
Enzymes [BR:chk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.31  homoserine O-acetyltransferase
     D4L85_12260 (metX)
    2.3.1.46  homoserine O-succinyltransferase
     D4L85_12260 (metX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Esterase Say1_Mug180 Hydrolase_4
Motif
Other DBs
NCBI-ProteinID: AYB31303
UniProt: A0A385SHU4
Position
complement(2836922..2837974)
Genome map
AA seq 350 aa AA seqDB search
MEKNDQTFHYQKKFELESGSTLPGFQLKYSTLGKLNADRSNVVWVCHALTGSADFTDWWS
GLFNEGRFFDPRQYFIICANVLGGCYGSTGHLSLNPETGKPYYHTFPTLTNRDVVQAFDL
LRQSLGIEQVHTLIGGSLGGQQVLEWAVQQPDVFQHIIPIATNAVHSPWGIAFNEAQRMA
IEADATWKENDHRAGTEGLKAARAIGMISYRYYDTYGQTQAEKSDEKIDDFRAATYQRYQ
GQKLANRFNAFTYYSLSRMMDSQNVGRNRGGLVAALKSIKARTLVVGIDSDILFPLSEQK
FLTENIPNARLEVMTSLYGHDGFLVEFEQLSSHIKKFFLEDLVPVEVKVR
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagaacgatcaaacctttcattatcagaaaaaatttgaactggaatcgggcagc
acattgccgggcttccagctcaaatactccacgctcggcaagctcaatgccgaccgcagc
aatgtggtctgggtttgccatgccttgacgggcagcgccgacttcaccgactggtggagc
ggacttttcaatgaagggagattcttcgatccacgccaatattttattatttgtgccaac
gtgctgggcggatgctacggctccaccggccacctgtcgctgaaccctgaaacgggcaag
ccctattatcacacctttcctacgctgaccaaccgcgatgtggtgcaggcctttgatttg
cttcgccagtccctcggcatcgagcaagtgcacacactcatcgggggatcgttgggcgga
cagcaggtgttggagtgggctgtgcagcaacccgatgtttttcaacacatcattcccatc
gccacaaatgccgtgcactcaccctggggcatcgccttcaatgaagcacagcgcatggcc
atcgaagccgatgctacctggaaagagaacgatcatcgcgccggcaccgaaggcttgaaa
gccgcccgcgcgatcggcatgatctcgtatcgctattatgatacctatggccagacacaa
gccgagaaaagcgacgagaagatagacgatttcagagcggccacttaccagcgctatcag
ggccaaaagctggccaaccgtttcaacgcgttcacctattacagcctctcccggatgatg
gacagtcagaacgtggggcgcaaccgcgggggccttgtagccgcattgaagtccatcaaa
gcaagaacactcgtcgtgggcatcgattccgatattttgtttccgctaagcgaacaaaaa
ttccttaccgagaacattcccaatgcccgactggaagtgatgacttccctttacggccac
gacggttttttggtcgagtttgaacaattgagcagtcacataaaaaaattcttcctcgaa
gacctcgtcccggtggaagtaaaggtccgataa

DBGET integrated database retrieval system