KEGG   Chryseolinea sp. KIS68-18: D4L85_17205Help
Entry
D4L85_17205       CDS       T05641                                 

Definition
(GenBank) low specificity L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
chk  Chryseolinea sp. KIS68-18
Pathway
chk00260  Glycine, serine and threonine metabolism
chk01100  Metabolic pathways
chk01110  Biosynthesis of secondary metabolites
chk01120  Microbial metabolism in diverse environments
chk01130  Biosynthesis of antibiotics
chk01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:chk00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    D4L85_17205
Enzymes [BR:chk01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     D4L85_17205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_5 DegT_DnrJ_EryC1 Pyridoxal_deC Aminotran_1_2 PARP
Motif
Other DBs
NCBI-ProteinID: AYB32204
UniProt: A0A385SMI0
Position
complement(4029962..4030987)
Genome map
AA seq 341 aa AA seqDB search
MNPTFASDNYSGVHPEIMDALQRANPGHVGSYGADPLTAEATKKFKTLLGEDIEVFFAYN
GTGANVLGLSAMTRSFDSIICSDLAHINVDESTAPERFTGCKLVTIPTRDGKIYPHEIEE
KIQRVDDQHHPQVRVISISQTTEYGTVYSIDELKAISAVAKKHNLLFHMDGSRISNAAVS
LQAEFRAFTRDAGVDVLSFGGTKNGMMFGEAVVFFNTELAKNFKYIRKQGMQLHSKMRFI
SAQFDALLTNDLWRRNASHSNGMAKLLEAEIRQSPKAKITQKVDANGIFVILPQEIIPAL
QEEHFFYVWNDKLSEARLMCSFDTTEADVRSFGKKLRELLK
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaaccctactttcgccagcgacaactattcgggcgttcacccggaaattatggacgcc
ttgcaacgcgccaaccccggtcatgtgggatcgtatggcgccgacccgctcacggcggag
gccaccaaaaaattcaagacgttactgggcgaagatatcgaggtgttctttgcctacaac
ggcaccggcgccaacgtgctggggctaagcgccatgacacgctcgttcgattcgatcatc
tgctccgacctcgcccacatcaacgtggacgagtccaccgcaccggaacggttcacgggc
tgcaagctggtgaccatccccacccgggatggcaagatctatccgcacgagatcgaagaa
aagatccaacgcgtcgacgaccagcaccatccgcaggtgcgcgtcatttccatttcgcaa
accacggaatatggcaccgtctattccatcgacgagctgaaagcgatatcggcagtagca
aaaaaacacaatctgcttttccacatggatggctcgcgcatctccaacgccgccgtgagc
ctgcaagccgagttcagggcgtttacccgcgatgccggggtggacgtgctttcgtttgga
ggaacaaaaaacgggatgatgttcggtgaggccgtagtgttcttcaacacggaattggct
aagaattttaaatacatccgcaagcaaggcatgcaactgcactcgaagatgcgcttcatc
agcgcacaattcgacgcgctgctcacgaatgatctgtggcgccggaatgccagtcactcc
aacggcatggctaaattgttggaggccgaaatacgtcaatcgccaaaagcaaagatcacc
cagaaggtagacgccaacggcatctttgtgatccttccccaggagatcatccccgcgctg
caagaagagcatttcttctatgtgtggaatgacaaattatcggaagcacgattgatgtgc
tccttcgataccacggaggcagacgttcggagctttggtaaaaaattacgggaattgttg
aagtag

DBGET integrated database retrieval system