KEGG   Chryseolinea sp. KIS68-18: D4L85_25310Help
Entry
D4L85_25310       CDS       T05641                                 

Gene name
apaG
Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
chk  Chryseolinea sp. KIS68-18
Brite
KEGG Orthology (KO) [BR:chk00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    D4L85_25310 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: AYB33694
UniProt: A0A385SS43
Position
complement(6038210..6038596)
Genome map
AA seq 128 aa AA seqDB search
MVTEITQGIKVSVETEYQPAYSSPSQYHYVFTYRITIENHSEYTIQLLRRHWHIFDAGFT
QREVEGEGVVGQQPVLEPGQAHQYVSGCNLKSGIGKMVGTYLMERVVDGTTMQVNIPEFT
MVAPLRLN
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atggtaacggaaatcacccaaggtatcaaggtaagtgtcgagacggaataccagccggcg
tattccagcccgagccaataccactatgtgtttacctaccgcattaccatcgaaaaccac
agcgaatacaccatccaactcctccgcagacactggcatatttttgatgccgggttcacc
caacgcgaagtggaaggtgaaggtgtggtaggccagcaacccgtgctcgaacccggccag
gcacaccaatatgtttccggctgcaacctcaaatcgggcattggcaaaatggtaggcacc
tacctgatggagcgcgtcgtggatggtaccaccatgcaggtgaatattcccgagttcacc
atggttgcccctctccgactcaactga

DBGET integrated database retrieval system