KEGG   Chryseolinea sp. KIS68-18: D4L85_32255Help
Entry
D4L85_32255       CDS       T05641                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
chk  Chryseolinea sp. KIS68-18
Pathway
chk00480  Glutathione metabolism
chk00590  Arachidonic acid metabolism
chk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:chk00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    D4L85_32255
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    D4L85_32255
Enzymes [BR:chk01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     D4L85_32255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: AYB35796
UniProt: A0A385SYN5
Position
complement(7734473..7734931)
Genome map
AA seq 152 aa AA seqDB search
MASSVYDFKKTAIDGQVIDFAKYKGKPLLIVNTASKCGFTPQYAELQKLQDQYGSKVTIL
GFPANNFGAQEPGTNVEISEFCQKNYGVTFQMFEKVSVKGSDQDELYAWLKEKTGEEPTW
NFCKYLVKPDGTVKFFPSKVSPLDKQIIDALN
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atggcctcttctgtgtatgatttcaagaaaacggctatcgacggacaggtcattgatttt
gccaagtataaaggcaagcccttgctcattgtgaacaccgcttccaaatgcggcttcacc
ccacagtatgccgagcttcaaaaattgcaggaccagtatggcagcaaagtgaccatcctc
ggtttccccgccaacaattttggcgcgcaagaacccggcacgaacgtggagatctctgaa
ttttgccaaaagaactatggtgtgacgttccagatgtttgaaaaagtatctgtgaaaggc
agcgaccaggatgagctctacgcttggttgaaagaaaagaccggcgaagaacccacctgg
aatttctgcaaatacctggtgaagcccgatggcacggtgaaattctttccttcgaaagta
agcccgctcgacaagcaaattattgatgcgcttaattaa

DBGET integrated database retrieval system