KEGG   Chloroflexus aurantiacus Y-400-fl: Chy400_0108Help
Entry
Chy400_0108       CDS       T00859                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
chl  Chloroflexus aurantiacus Y-400-fl
Pathway
chl00071  Fatty acid degradation
chl00280  Valine, leucine and isoleucine degradation
chl00281  Geraniol degradation
chl00310  Lysine degradation
chl00360  Phenylalanine metabolism
chl00362  Benzoate degradation
chl00380  Tryptophan metabolism
chl00410  beta-Alanine metabolism
chl00627  Aminobenzoate degradation
chl00640  Propanoate metabolism
chl00650  Butanoate metabolism
chl00903  Limonene and pinene degradation
chl01100  Metabolic pathways
chl01110  Biosynthesis of secondary metabolites
chl01120  Microbial metabolism in diverse environments
chl01130  Biosynthesis of antibiotics
chl01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:chl00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Chy400_0108
   00650 Butanoate metabolism
    Chy400_0108
  Lipid metabolism
   00071 Fatty acid degradation
    Chy400_0108
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Chy400_0108
   00310 Lysine degradation
    Chy400_0108
   00360 Phenylalanine metabolism
    Chy400_0108
   00380 Tryptophan metabolism
    Chy400_0108
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Chy400_0108
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Chy400_0108
   00281 Geraniol degradation
    Chy400_0108
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Chy400_0108
   00627 Aminobenzoate degradation
    Chy400_0108
   00930 Caprolactam degradation
    Chy400_0108
Enzymes [BR:chl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Chy400_0108
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49 SDH_sah
Motif
Other DBs
NCBI-ProteinID: ACM51551
Position
135384..136160
Genome map
AA seq 258 aa AA seqDB search
MSEESLVLSTIEGPIAILTLNRPQALNALSPALIDDLIRHLEACDADDTIRVIIITGAGR
AFAAGADIKAMANATPIDMLTSGMIARWARIAAVRKPVIAAVNGYALGGGCELAMMCDII
IASENAQFGQPEINLGIIPGAGGTQRLTRALGPYRAMELILTGATISAQEALAHGLVCRV
CPPESLLDEARRIAQTIATKSPLAVQLAKEAVRMAAETTVREGLAIELRNFYLLFASADQ
KEGMQAFIEKRAPNFSGR
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaagagtctctggttctcagcacaattgaaggccccatcgccatcctcaccctc
aatcgcccccaggccctcaatgcgctcagtccggccttgattgatgacctcattcgccat
ttagaagcctgcgatgccgatgacacaatccgcgtgatcattatcaccggcgccggacgg
gcatttgctgccggcgctgacatcaaagcgatggccaatgccacgcctattgatatgctc
accagtggcatgattgcgcgctgggcacgcatcgccgcggtgcgcaaaccggtgattgct
gccgtgaatgggtatgcgctcggtggtggttgtgaattggcaatgatgtgcgacatcatc
atcgccagtgaaaacgcgcagttcggacaaccggaaatcaatctgggcatcattcccggt
gctggtggcacccaacggctgacccgcgcccttggcccgtatcgcgcaatggaattgatc
ctgaccggcgcgaccatcagtgctcaggaagctctcgcccacggcctggtgtgccgggtc
tgcccgcctgaaagcctgctcgatgaagcccgtcggatcgcgcaaaccattgccaccaaa
tcaccactggctgtacagttggcgaaagaggcagtccgtatggccgccgaaaccactgtg
cgcgaggggttggctatcgagctgcgtaacttctatctgctgtttgccagtgctgaccaa
aaagaggggatgcaggcatttatcgagaaacgcgctcccaacttcagtggtcgttga

DBGET integrated database retrieval system