KEGG   Chloroflexus aurantiacus Y-400-fl: Chy400_0449Help
Entry
Chy400_0449       CDS       T00859                                 

Definition
(GenBank) magnesium chelatase ATPase subunit D
  KO
K03404  magnesium chelatase subunit D [EC:6.6.1.1]
Organism
chl  Chloroflexus aurantiacus Y-400-fl
Pathway
chl00860  Porphyrin and chlorophyll metabolism
chl01100  Metabolic pathways
chl01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:chl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Chy400_0449
Enzymes [BR:chl01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Chy400_0449
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VWA_2 VWA AAA_5 VWA_3 VWA_CoxE Sigma54_activat Mg_chelatase MCM AAA_25 AAA_32
Motif
Other DBs
NCBI-ProteinID: ACM51888
Position
544635..546539
Genome map
AA seq 634 aa AA seqDB search
MVQKAIALPAAPLPFTAIVGLDTARQALLLLAVDPSLAGVAIGAGAGTGKSALVRAFARM
LAGGREFDPTIPWQLVEMPVGVSEDRLLGGIDIEATLATGERVHRSGLLARANGGMLYVD
SVNLLDDSTINHILSALDSGVVRVEREGISVVEPARFVLLVTYDPAEGPPRRHLLDRLGL
IVAPIGKAPVTTRAEVVRRNLQPGTDYEDDEALVLAGILAARELLPSVTISDEQVQQLSL
TAMALGIEGHRADLFAVRAARAAAALAGREEVNNDDLELAVRLVMLPRATRLPEMTPEEA
GPPPPPEPAPPPPSPENSDDEQRDDEEEKPPQPPEDELTIEELILAAMETDVPPDILETP
FTVRRRGRSGSRGTISGQRGRHIRSVPGKPAQGRLDVIATLRAAAPWQRIRAAEYHPHRR
GRIHLRADDLHIKKYRSKAGTLFCFLVDASGSMALHRMRQAKGAVNALLQQAYVHRDQVA
LLAFRGERADLLLPPSQSVELAKRALDVLPTGGGTPLAAALLAAYQISEQARSRGIFRTT
IVLITDGRPNVPLKADPTMDKARRLEQARQEVQQLAGRLRAAGVGAVVIDTQRSFVSRGE
AQQLAAWLGGRYVYLPNGRGDQIANAVIAASEEG
NT seq 1905 nt NT seq  +upstreamnt  +downstreamnt
atggtgcaaaaagccattgcattaccggcagcgcctctgccattcacggcaattgttggc
ctggatacggcccggcaggcgctgctgttgctggcggttgatccatcactggccggggtt
gcgattggggccggcgccggcaccggcaaaagcgcactggtacgggcttttgcccgtatg
ctggccggtggtcgtgaatttgatccgaccatcccctggcagttggtcgagatgccggtc
ggcgtgagcgaagatcgactgctgggggggatagatattgaagcaaccctggcgacgggt
gagcgtgtccatcgcagcggtctgctggcccgcgccaatggcggcatgctctatgtggat
agtgtgaatctgctcgatgacagcacgatcaaccatattttgagcgcactcgatagcggt
gttgtgcgggtcgaacgggagggaatttcggtcgttgaaccggcccgcttcgtgttgctg
gtaacttacgatccggcagaagggccacctcgtcgccacttactcgaccgcctgggattg
attgtggcgccaattgggaaagcgccggtaacgaccagagctgaagtggtgcgtcgtaac
ttgcaacccggcaccgattacgaagatgacgaagcgctggtattggccggcatcctggct
gcacgtgagctattgccttcagtcaccatcagtgatgagcaggtccagcagttgagcctg
acagcgatggcactcggtattgaaggtcatcgtgccgacctgtttgcagtacgtgcagcc
cgcgccgccgctgcactggccggacgggaagaggtgaataacgacgatctcgaactggca
gtacgattggtcatgctgccacgcgcaacccgcctccccgaaatgacgccggaagaggcc
gggccgccgccaccaccggaaccggcgccacctccgccatcaccagagaatagtgacgat
gagcagcgcgacgatgaagaggaaaaaccaccgcagccgcctgaagacgagctgaccatc
gaagagctgattctggcagcgatggagactgatgtgccgccagacattctcgaaacaccg
tttaccgtgcggcgacgcggacggagcggctcacgcggcacaatttcgggtcagcgcggg
cgacatatccgctcggtgccggggaaaccggctcagggacggctcgatgtcattgccacg
ctgcgggcagccgcgccatggcaacggattcgggcagcggaataccatccccaccgacgc
ggacgtatccatctgcgtgctgatgatttgcatatcaagaaatatcgctcgaaggcagga
acgctcttctgctttctggttgatgccagcggttcgatggcgctgcaccggatgcgccag
gccaagggagcggttaatgcgctcttgcaacaggcctacgttcaccgcgaccaggtagcg
ttactggcattccgtggcgaacgcgccgacctgctactccccccatcacaaagcgtcgag
ctggccaaacgcgccctcgatgtcttgccaaccggtggtggtacccccctggccgcagcc
ctcctcgctgcgtaccagattagcgaacaggcccgctcacgaggcatcttccgcacaact
atcgtcttgatcaccgatggacggccaaacgtcccgctcaaagccgatccgacgatggac
aaagcacggcgactcgaacaggcccggcaagaagtgcaacaactggccggtcggctgcgt
gccgccggtgttggcgcggttgtgatcgacacccagcgcagctttgtgtcgcgtggtgaa
gcacaacaactggcggcctggctgggtggacgttatgtctacctgcctaacggacgaggt
gatcagatcgccaacgcggtgattgcagccagtgaggagggttaa

DBGET integrated database retrieval system