KEGG   Chloroflexus aurantiacus Y-400-fl: Chy400_0695Help
Entry
Chy400_0695       CDS       T00859                                 

Definition
(GenBank) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
chl  Chloroflexus aurantiacus Y-400-fl
Pathway
chl00860  Porphyrin and chlorophyll metabolism
chl01100  Metabolic pathways
chl01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:chl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Chy400_0695
Enzymes [BR:chl01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Chy400_0695
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     Chy400_0695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 FAD_binding_2 DAO FAD_oxidored GIDA HI0933_like Pyr_redox_2 Thi4 FAD_binding_3 Pyr_redox Pyr_redox_3 MCRA AlaDh_PNT_C Lycopene_cycl Trp_halogenase
Motif
Other DBs
NCBI-ProteinID: ACM52125
Position
866583..868007
Genome map
AA seq 474 aa AA seqDB search
MMAGYDSVVIGGGIAGLAAAYTLHKRGYRVLVIESTNRVGGVIQTITTPEGYILDCGPNT
VGTGDARLWQELIDLGLRERITPAAPCSKRRFILINGTPVEIPTSPVGLITTRLLSWRGK
LRVLAEPFINRGSTDPDESVAAFFTRRIGAEATAHLLDPFVAGVYAGDPQRLSTAAVFPS
LWEAAQRSGSIVRGMLSKPKPKTQVSEPKMRSRTFTFRGGLAEWPRALAQALGAGNVWTE
RRVVKLQPRDSWWEVTIDGVNGPETLISRSLIIATPAFTAADLIESVDQRAAGALRGIPY
APVAVVHLGFRRDQISQELSGFGVLAPSSEQRQFLGILWTSSIFPHVAPHDHVLTTTLSG
GAIRPELAERSDETLIEAAIRDHHQLLGIRGQPIFTHVTRWRTAIAQYTFGHRERIATLV
QLEQRLPTIQFAGSYRDGVGVPKTWASGVQAGERIAAALAAHGTTAVSTETASG
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgatggcgggatacgacagtgtagtgattggcggtggcattgccggtttagctgcggct
tacacgctccacaagcgtggttatcgggtcctggtcatcgagtcgaccaatcgcgttggc
ggtgtgatccagaccatcaccacaccagaaggctacattctcgattgtgggccgaacacg
gtgggtaccggcgatgcgcgattgtggcaggaactgatcgatctgggtctgcgcgagcgg
atcacaccggcagcgccatgtagcaaacggcggttcatcctgatcaatggtacaccggtt
gaaatcccaacctcaccagtcgggctgattaccacgcgattactctcgtggcgggggaaa
ttgcgggtactggccgaaccgttcatcaaccgtggatcgaccgatcccgatgaaagcgtt
gctgccttcttcacccgccggattggtgcagaggctaccgcccacctcctcgatccattt
gttgccggcgtctacgctggcgatccgcaacggctctcgactgcggcagtctttccatca
ctgtgggaagcggcccagcgcagtggcagcatcgtgcgcggcatgctgagcaaacccaaa
ccgaagactcaggtgagtgagccaaagatgcgcagccgcacctttaccttccgcggtggc
ctggccgaatggccacgcgctctggcgcaagccctgggtgccggcaatgtctggacagaa
cggcgcgtggtcaagctccaaccacgcgactcctggtgggaagtgacgattgatggtgtg
aacggcccggagacactcatcagtcgcagcctcattatcgccaccccagcctttacggcg
gctgatctcattgagtcggttgatcaaagagcggctggtgccctacgcggcattccgtat
gcgccggtagcagtggtacatctcggctttcgtcgtgaccagatcagccaggaattgagc
ggctttggtgtgctggccccctcaagcgaacagcgtcagttcctcggcattctctggaca
tcaagcatcttcccgcacgttgcaccacacgatcatgtcctcaccacaaccctcagtggt
ggtgctatccggcccgaactggccgaacggagtgacgaaacactgattgaagcggccatt
cgcgatcatcaccagctcctggggatcagagggcaaccgatcttcacccatgttactcgc
tggcgaaccgccattgcccagtatacctttgggcaccgcgagcggattgccaccctcgtg
caactcgaacagcgcctgccgaccatccagtttgccggcagctaccgcgacggcgttgga
gtgcccaaaacctgggccagcggtgtgcaggcaggcgagcggatcgctgcggcactggca
gcccatggaactaccgcagtttccacagagacggcgtcggggtga

DBGET integrated database retrieval system