KEGG   Chloroflexus aurantiacus Y-400-fl: Chy400_0739Help
Entry
Chy400_0739       CDS       T00859                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
chl  Chloroflexus aurantiacus Y-400-fl
Pathway
chl00260  Glycine, serine and threonine metabolism
chl00400  Phenylalanine, tyrosine and tryptophan biosynthesis
chl01100  Metabolic pathways
chl01110  Biosynthesis of secondary metabolites
chl01130  Biosynthesis of antibiotics
chl01230  Biosynthesis of amino acids
Module
chl_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:chl00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Chy400_0739
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Chy400_0739
Enzymes [BR:chl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Chy400_0739
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB BtpA
Motif
Other DBs
NCBI-ProteinID: ACM52169
UniProt: B9LKB2
Position
924644..925444
Genome map
AA seq 266 aa AA seqDB search
MSRIAETFARLRAAGRIALMPYLTVGFPERTSTLELVPALEAAGASLFELGIPFSDPLAD
GTTIQRATQRALENGITIADCIATVAELRARRVAAPLLLMGYYNPLLRYGLERACAALAA
AGGDGWIIPDLPLEEADDLRQLAAAHQLDLIMFIAPTTPPARISQITAQASGFLYIVSLT
GVTGARQTLAGNLTDLIANVRQQTNLPLVVGFGISQPAHIAEVARIADGAIVGSALIDRL
ERLPPEDRVSGAAAYIRELLSAVARP
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgagccgaatagccgaaacatttgccagactccgcgctgcggggcgtattgcgctaatg
ccatacctgaccgtaggttttcccgaacgcaccagcacccttgaactggtaccggccctc
gaagcagccggcgccagtctgtttgaattgggcatccccttctccgatccgctggcagac
ggcacgaccattcagcgggcgacccagcgcgctctggaaaacgggattacgattgccgat
tgtattgcaacggtcgccgaattacgggcccgtcgggtggcggcccccctgctgttgatg
gggtactacaacccgttgctccgttacggtctcgaacgcgcctgtgccgctctggcggca
gccggtggcgatggctggattattcccgatctgccgctcgaagaagcagatgatctccgt
cagcttgccgctgctcaccagctcgacctgataatgttcatcgcccccaccaccccaccg
gcccggatcagccagatcactgcccaggccagtggctttctttacatcgtctcgctaacc
ggtgtgaccggtgcccggcagactttagccgggaatctgaccgatctgattgccaatgtg
cgccagcagacgaatctgccactggttgtcggttttgggatcagccagccagcgcatatt
gctgaagtagccaggattgccgatggagcaattgttggcagtgccttgattgatcgcctg
gaacgtctgccacctgaagaccgggtgagtggtgccgctgcgtatattcgcgaactgttg
agcgccgttgcacgaccgtaa

DBGET integrated database retrieval system