KEGG   Chloroflexus aurantiacus Y-400-fl: Chy400_1352
Entry
Chy400_1352       CDS       T00859                                 

Name
(GenBank) sulphate transporter
  KO
K03321  sulfate permease, SulP family
Organism
chl  Chloroflexus aurantiacus Y-400-fl
Brite
KEGG Orthology (KO) [BR:chl00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:chl02000]
    Chy400_1352
Transporters [BR:chl02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   Chy400_1352
SSDB
Motif
Pfam: Sulfate_transp Rhodanese STAS MFS_MOT1 STAS_2
Other DBs
NCBI-ProteinID: ACM52773
Position
1726901..1729012
AA seq 703 aa
MLDYLRTVAILFAQPIRLVRTFTPDTLRADFLAGLTVGLVLLPQSLAFAILGGLPPIVGL
YSALTATIVGALWGSSSHLNSGPTNTAAIITLSVLAPIITVGSSEFVTAASLIAVMAGII
RLVMGIARLGMLVNFVSDAVAVGFTAGAGILILSNQIGPLLRIDLPPGAGILTTITETAT
HLDAIHLPSLAIGLATIIIILLAPRFTRKVPAVLLSITIVSPIVWFLDLKAQGVRVMGPV
PPGLPPLAQLPIFDLDLIGHLANGALALAIIGLVEAVAIARAIAGYSGQRIDSNQEFVGQ
GLANIVSGIFSGMPCSGSFNRSALAYQSGGQTALTAIVSGITVFLATTVLGPFLAEVPRA
ALAGALAVTAWSMVDQRAMARIWRGSRGEAVIMITTLTLTLTLPLQFAILIGVLMSLGYY
LLRTAMPRVEAVVPDTEFRHWESAYGRPMCPQLLVVDLQGDLYFGAVNHVEEQLLNLLER
QRQARYMLLRMHSVNQCDVSGIRALETIRRVLRVRGGDLFFVRVRASVMYRMQISGFYEQ
LGAERFLDEDKAIEYLFYRVLDPAVCIYECDRRVFRECQELPKQLLPSPVEIPVLDGKRP
VHVTARRLWELLHTDHPPLIIDVREPREFQRGHIPGARNLPLSRLFHERDQLPPGPIVLV
CRSGRRSLRAAALLAGRNPPPHILEGGMLAWEAANLLEAVEQF
NT seq 2112 nt   +upstreamnt  +downstreamnt
atgctcgactatttacgtacagttgccattttgttcgcccaaccaatccggttggtacgt
accttcacgcctgacacattgcgggctgactttctggctggcttaaccgttgggctggtt
ttgttaccgcaatcgctggcctttgcgattttgggcggactgccgccaattgttggcctg
tatagtgcgttgacagctacaattgttggtgcgctgtggggatcatcgagccatctcaac
agtggccccaccaacaccgctgctatcatcaccttatcggtgctggcgccgattataact
gtcggcagttccgaatttgtcactgcggccagcctgattgccgtcatggccggtatcatc
cgactcgtgatggggattgcacggctgggcatgctggttaactttgtctccgatgcggtg
gccgttggcttcactgccggagccggtattctcattctctcgaatcagattggcccactc
ttgcggattgatcttccgccaggtgccggtatcctgacaaccatcaccgaaacggcgacc
catctcgatgctattcacttgccgtcgctagcgattggcctcgcaacgattattatcatt
ctccttgcaccacgcttcacccgcaaagtgccggcggtattactcagtattactatcgta
tcaccgattgtctggttcctcgatctcaaagctcagggggtgcgcgtcatgggaccggtg
ccaccgggattaccgccactggcccaactccccatcttcgacctggacttgatcggccat
cttgcgaatggtgcattagcgttagcgattattggtctggttgaggcagtagcaattgca
agggcgattgccggctatagcgggcaacgcatcgacagcaaccaggaatttgtcggacaa
ggactggccaatatcgtctctggtatcttttccggtatgccttgctccggctcgtttaac
cgttcggcgctggcgtatcaatcgggtgggcagacagcactgaccgcgattgtctccggg
atcacagtatttttggctacaacggtgctggggccatttctggctgaggtaccgcgggct
gctttagccggtgcgctggccgtaactgcgtggagcatggttgatcagcgtgcaatggct
cgcatctggcgtggatcgcgcggtgaagcggtgatcatgatcacaacgctcacgcttacc
ctgacactaccactccagttcgccattcttatcggtgttctcatgtcgcttggctactac
ctattgcgcacggctatgccgcgtgtggaagcagtggtacccgatactgaatttcgccat
tgggagtcggcctacggacggccaatgtgcccgcagttgctggtggttgatctgcaaggt
gatctctacttcggcgctgtaaatcacgtggaagaacaattgctcaacctgctcgaacga
caacggcaggcgcgctatatgctcttgcgcatgcacagtgtcaaccagtgcgatgtgagt
ggaatccgtgcgctggaaaccatccggcgtgtcttgcgggtacgcggtggtgatctcttc
ttcgtgcgggtacgggccagtgtgatgtatcgtatgcagatcagcgggttttatgaacaa
ctcggcgccgaacgcttcctcgacgaagacaaagctatcgaatatctgttttaccgggtg
ctcgacccggcggtctgcatttatgaatgtgaccggcgcgtctttcgcgagtgtcaggag
ctacctaaacaactgctccccagcccggtcgagatacctgtactcgatgggaagcgtcct
gtccatgtgacggcgcgccgattgtgggaattactccacaccgaccatccacccctgatc
attgacgtgcgcgaaccgcgcgaatttcagcgcggccacattcccggtgcgcgcaacctt
ccgctctcacggttattccacgaacgtgatcagttaccacctggccccatcgtgttggtc
tgtcggagtggtcggcgcagtctgcgcgcagccgccttactggccggtcgtaacccacca
ccccatattctcgaagggggcatgctggcctgggaagcggcgaatctacttgaagcggtt
gagcagttttga

DBGET integrated database retrieval system