KEGG   Chloroflexus aurantiacus Y-400-fl: Chy400_2528Help
Entry
Chy400_2528       CDS       T00859                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
chl  Chloroflexus aurantiacus Y-400-fl
Pathway
chl00010  Glycolysis / Gluconeogenesis
chl00052  Galactose metabolism
chl00500  Starch and sucrose metabolism
chl00520  Amino sugar and nucleotide sugar metabolism
chl00521  Streptomycin biosynthesis
chl01100  Metabolic pathways
chl01110  Biosynthesis of secondary metabolites
chl01120  Microbial metabolism in diverse environments
chl01130  Biosynthesis of antibiotics
chl01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:chl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Chy400_2528
   00052 Galactose metabolism
    Chy400_2528
   00500 Starch and sucrose metabolism
    Chy400_2528
   00520 Amino sugar and nucleotide sugar metabolism
    Chy400_2528
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Chy400_2528
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Chy400_2528
Enzymes [BR:chl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Chy400_2528
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG
Motif
Other DBs
NCBI-ProteinID: ACM53920
Position
complement(3176257..3177228)
Genome map
AA seq 323 aa AA seqDB search
MKDLPALIRERLTQNLWGVLGNQGYILGIDLGSYGLRAALVDLQHHTYQNAALESIDHED
PETTVRRVIDLARDLMAQEGVTVERLVRVGVGFSGPVDLRHGTVRLAPRRPGWENYPLQE
RFEQAFDAVTLIDNDANLIALGEATFGVGKGCQHLFYFHLSSGVGGGAVLNGRLYHGAHS
MAGEIGHAVVAHGWDGDGRPETLEELVSIGGLIRRAAAAGLAADRLEDIFSDHPIARKVV
QHTVDLMATRIAQVIALLDPEMVVLGGIVVRIGGDRFVEAIATRVNDFIAPQFARPVPVV
ASILGPDSVAIGAVAMALDSLSD
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatctgcctgcccttattcgagaacggttgacgcagaacctctggggcgtcctt
gggaatcaaggctacatccttgggatcgacctgggcagttacggattacgagctgcattg
gtcgacttgcagcaccacacctaccagaatgccgctctcgagtcgattgatcatgaagac
ccagagacaacggtacgccgggttatcgatctggcgcgagatttgatggcgcaggaaggt
gttaccgtcgagcgcctggtacgggttggcgtaggctttagcggcccggttgacctccgc
catggcacggtacggctggccccacggcgaccggggtgggaaaattaccccttgcaagag
cgtttcgagcaggcgtttgatgccgtgacgctcattgacaacgatgcgaatctgatcgcc
ctgggagaggcaacctttggtgtcggcaaaggatgccagcatctattttactttcacctg
agcagtggcgttggcgggggcgcagtgctgaacggtcgcctgtaccatggcgcccactca
atggccggcgaaatcgggcatgcagtggttgcccacggctgggatggcgatggtcgcccg
gagaccctggaagagctggtttcgataggaggattaatccgccgggcagccgccgcaggg
cttgccgcggatcgactggaagatatttttagcgatcatccgattgcccgcaaggtagta
cagcataccgttgatctcatggccacccggattgcgcaagtgattgcactgctcgatcca
gagatggttgtcctgggaggaatcgttgtgcggatcggtggtgatcgcttcgtggaagcg
attgcgaccagagtgaacgacttcatcgccccacagttcgcccgtcccgtaccggtggta
gcgtcaatccttggccccgatagcgtcgcaattggcgctgtcgcgatggcactcgatagc
ctgtcggattga

DBGET integrated database retrieval system