KEGG   Chloroflexus aurantiacus Y-400-fl: Chy400_2805Help
Entry
Chy400_2805       CDS       T00859                                 

Definition
(GenBank) Porphobilinogen synthase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
chl  Chloroflexus aurantiacus Y-400-fl
Pathway
chl00860  Porphyrin and chlorophyll metabolism
chl01100  Metabolic pathways
chl01110  Biosynthesis of secondary metabolites
chl01120  Microbial metabolism in diverse environments
Module
chl_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:chl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Chy400_2805
Enzymes [BR:chl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Chy400_2805
Exosome [BR:chl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Chy400_2805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-ProteinID: ACM54193
Position
3456209..3457267
Genome map
AA seq 352 aa AA seqDB search
MDVLSRHTPATNGTTTQVPTPVHRPRRLRISPAMRDLVRETRLTPAQLIAPIFVRHGHNL
RNPIASMPGQYQMSPDQAAREARELAALGIRAVLLFGIPAHKDPCGSENADPAGIVPQAI
QAIKAEVPGMVVISDMCFCEYTDHGHCGVLNTPTRDDFQPQLGEGYLLNDPTLALLAEAS
IVHARAGADIIAPSGMIDGMVAAIRSALDAAGLSHTAIMSYAAKYASGFYGPFRDAAESP
PQFGDRSQYQMDPANAREALREVDLDVAEGADILMVKPALAYLDIIRQVRDRHTLPLAAY
QVSGEYSMVKAAALQGWLDEQRIALEMLTAIRRAGADMIITYWAREAAEWLG
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
gtggatgtgctctcacgtcatacaccggctacgaatggcacaacgacacaggtaccaacg
ccggttcaccgtccgcgccggttgcggatcagtccggccatgcgcgatctggtgcgcgaa
actcgcctgacaccggcccagttgattgccccgatctttgtccgtcacggccataacctg
cgcaatccgattgcctcgatgcccggtcagtaccagatgtcacccgaccaggctgcccgc
gaagcacgcgagctggcggcgctcgggattcgggccgtgctcctgtttgggattccggcc
cacaaggatccgtgtggtagcgagaatgccgacccggcggggattgtaccccaggccatc
caggccatcaaagctgaagtgccgggaatggtggttattagcgatatgtgcttctgcgag
tacaccgatcacggtcactgtggtgtgctcaacacaccgacccgcgatgattttcaaccg
cagttgggtgaagggtacctgcttaatgatccaaccctggcgctgctggccgaagcatcg
atagtgcatgcccgtgccggagccgatattattgccccttctggcatgatcgatggcatg
gtggcggcgattcgctcggcgctggacgctgcggggctgagccataccgcgatcatgagc
tatgccgcaaagtatgccagcggtttttatggccccttccgcgatgctgccgaaagtccg
cctcagttcggtgatcggagccagtaccagatggatccggccaatgcgcgtgaagcactg
cgtgaagtcgatctcgatgtggcggagggagcagatatcttgatggtcaaaccggcactc
gcctacctcgacattatccggcaggtgcgcgaccgccatacattgccgctggcagcgtat
caggtgagcggcgagtacagtatggtgaaggccgcagcattacagggctggctcgacgag
cagcggattgcgttggagatgctgaccgctattcgacgtgccggcgctgacatgattatc
acctattgggccagagaagccgccgaatggcttggatga

DBGET integrated database retrieval system