KEGG   Chloroflexus aurantiacus Y-400-fl: Chy400_3231Help
Entry
Chy400_3231       CDS       T00859                                 

Definition
(GenBank) phosphonate C-P lyase system protein PhnG
  KO
K06166  alpha-D-ribose 1-methylphosphonate 5-triphosphate synthase subunit PhnG [EC:2.7.8.37]
Organism
chl  Chloroflexus aurantiacus Y-400-fl
Pathway
chl00440  Phosphonate and phosphinate metabolism
chl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:chl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    Chy400_3231
Enzymes [BR:chl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.37  alpha-D-ribose 1-methylphosphonate 5-triphosphate synthase
     Chy400_3231
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PhnG PhnI
Motif
Other DBs
NCBI-ProteinID: ACM54609
Position
complement(4031260..4031679)
Genome map
AA seq 139 aa AA seqDB search
MLTLSHILSCSPPHLVCELADQVLACYDQHAIRFISGPRYVLVQLRMRDGVAETLFNAGE
ILVTETRLELNGQFGFGMVIGRDPDHATALAILDAALRMPGDPHADLRPKIAALGHQLGT
AYERRFAAAAATRVDFETF
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgctaacgctatcgcacattctcagttgcagtccaccgcacctggtttgtgaattggcc
gatcaggtgctggcatgttacgaccagcacgcgatccgctttatcagcggtccccgctat
gtactggtacagttgcgtatgcgcgacggtgtggccgaaaccctgttcaacgccggggag
attctggtcaccgaaacccgcctggagctgaatggtcagtttgggtttggaatggtcatc
ggacgtgaccccgatcacgctacggcccttgccatcctggatgccgcgctccgtatgccg
ggcgatccccatgccgatctcagaccgaagattgccgcacttggtcaccagcttggcaca
gcatacgaacgccggttcgccgccgccgctgcaacgcgggtagatttcgagacattctga

DBGET integrated database retrieval system