KEGG   Chloroflexus aurantiacus Y-400-fl: Chy400_4132Help
Entry
Chy400_4132       CDS       T00859                                 

Definition
(GenBank) Triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
chl  Chloroflexus aurantiacus Y-400-fl
Pathway
chl00010  Glycolysis / Gluconeogenesis
chl00051  Fructose and mannose metabolism
chl00562  Inositol phosphate metabolism
chl01100  Metabolic pathways
chl01110  Biosynthesis of secondary metabolites
chl01120  Microbial metabolism in diverse environments
chl01130  Biosynthesis of antibiotics
chl01200  Carbon metabolism
chl01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:chl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Chy400_4132
   00051 Fructose and mannose metabolism
    Chy400_4132
   00562 Inositol phosphate metabolism
    Chy400_4132
Enzymes [BR:chl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Chy400_4132
Exosome [BR:chl04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Chy400_4132
  Exosomal proteins of bladder cancer cells
   Chy400_4132
  Exosomal proteins of melanoma cells
   Chy400_4132
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ACM55489
Position
complement(5117369..5118121)
Genome map
AA seq 250 aa AA seqDB search
MRIPLIAGNWKMYKTVGEATTLVRDLLAGLGELSDREAIVCPPFTALAAVAALVADSPLG
LGAQNLYPEAQGAFTGEVSPPMLVDIGCRYVIIGHSERRQYFGESDAFVNRKLRAALAHG
LRPIVCVGESKPQRDAGQAEPIVTAQVRAALLEVPPDQMANVVIAYEPIWAIGTGDTATP
ADAQAMHAAIRATLAELYGSEIAATVRIQYGGSVKPDNIDELMAQPDIDGALVGGASLQA
ASFLRIIHYQ
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgcgtattccattaatcgccggcaactggaagatgtacaagacggttggcgaagcaacg
acgctggtgcgcgatttgctggccggtctcggtgaattatcggatcgcgaagctatcgtt
tgtccgcccttcaccgcactcgctgccgtggcagcgctggtcgccgatagcccgctgggg
ttgggggcgcagaatctgtaccccgaagcgcagggtgcgtttaccggtgaggtctcgccg
ccaatgctggttgatattggctgtcgttacgtcattattggtcatagcgagcgtcgtcag
tattttggcgagagtgatgcgtttgtgaatcgaaaattgcgtgccgcccttgcccatggt
ctgcgtcccattgtgtgtgttggcgagagtaagccccagcgtgacgccgggcaggccgag
ccgattgtgacggcacaggtgcgtgctgccctgcttgaggtgcctccggatcaaatggca
aacgtggtgattgcttacgagccgatctgggccattggtaccggcgatacggcaactcct
gcggatgcgcaggcgatgcatgcggcaattcgggcaactctggccgaattgtacggttct
gagattgccgcaacggtacgtatccagtacggtggcagtgtgaagccggataatatcgac
gaattgatggctcagcccgatattgatggtgcgttggttggtggtgcttcgttacaggca
gccagttttctgcggatcatccattatcagtag

DBGET integrated database retrieval system