KEGG   Chlamydia sp. S15-834C: C834K_0457Help
Entry
C834K_0457        CDS       T05716                                 

Gene name
yqjI
Definition
(GenBank) 6-phosphogluconate dehydrogenase, decarboxylating 2,6-phosphogluconate dehydrogenase,Gluconate kinase,6-phosphogluconate dehydrogenase (decarboxylating),6-phosphogluconate dehydrogenase, C-terminal domain
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Organism
chla  Chlamydia sp. S15-834C
Pathway
chla00030  Pentose phosphate pathway
chla00480  Glutathione metabolism
chla01100  Metabolic pathways
chla01110  Biosynthesis of secondary metabolites
chla01120  Microbial metabolism in diverse environments
chla01130  Biosynthesis of antibiotics
chla01200  Carbon metabolism
Module
chla_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
chla_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:chla00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    C834K_0457 (yqjI)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    C834K_0457 (yqjI)
Enzymes [BR:chla01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.44  phosphogluconate dehydrogenase (NADP+-dependent, decarboxylating)
     C834K_0457 (yqjI)
    1.1.1.343  phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating)
     C834K_0457 (yqjI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 6PGD NAD_binding_2 F420_oxidored Shikimate_DH NAD_binding_11 3HCDH_N CobT_C Ub-Mut7C
Motif
Other DBs
NCBI-ProteinID: SYX08915
UniProt: A0A3B0PZX3
Position
I:485884..487329
Genome map
AA seq 481 aa AA seqDB search
MAEQADIGLIGLAVMGKNLVLNMIDHGFSVSVYNRSPEKTQKFLQENSQSTNLQGHENLE
AFVCSLKRPRKIMLMIKAGSPVDESIESLLPYLEAGDIIIDGGNSYYKDSERRCRDLKEK
GILFIGMGISGGEEGARYGPSIMPGGNSDAWPAIAPIFQGISAKVSGNPCCCWVGPGGAG
HYVKTVHNGIEYGDIQLICEAYGLLRTRLGISPESVSAIFSEWNSRELESYLMRISVEVL
SLKDSDGSPVIDTILDVAGQKGTGRWTAMDAIDSGVPLSLIIESVLARFLSSWKTVRDQA
AKELPGIPIVFEKPKDPHLFIEDVFQALYASKIISYAQGFMLLKQASEEHQWNLNLGELA
LLWRGGCIIQSVFLDAIHKGFENEPEAPSLILQTYFKSTLQNSESGWRRTIAYAIGSGYP
VPCLAAALTFYDGYRTKDSSIALAQGLRDYFGAHSYERKDRPRGEFYHTDWIGTKTTTLV
K
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
gtggcagagcaagcagatattgggctaattggtttagctgttatggggaaaaaccttgta
ttaaacatgatagatcatggtttttctgtttctgtctacaatcggagtccagagaaaact
caaaagtttcttcaggagaattctcaaagcacaaaccttcaggggcatgaaaatttagaa
gcttttgtttgttctttaaaacgtcctagaaaaatcatgcttatgatcaaagcaggaagc
cctgtagatgaaagtattgaatcattattaccttatcttgaagccggagatattattatt
gatggaggaaatagctactataaagattcagaaagacgatgccgggaccttaaggaaaaa
ggcattctttttataggcatggggatttccggaggtgaggagggagctaggtacggccct
tctattatgcctggaggcaatagtgatgcttggccagctatagcgcctatttttcaaggt
atttctgctaaagttagcggtaacccctgttgttgttgggttggacctggaggggcagga
cattatgtaaaaactgtacataatggcattgaatatggagatatccaattaatttgcgaa
gcttatgggttgctaagaacacgtttaggtatatctcctgagtctgtatcagcaattttt
tctgaatggaatagtcgggaattagaaagctaccttatgagaatttccgtagaggtactt
tctttaaaagattctgacggctctccagttattgatacaattttagatgttgcagggcaa
aaaggtacgggccgatggactgcaatggatgctattgattctggggttcctctttctttg
attattgaatctgtattagcacgctttctttcctcatggaaaactgttcgagatcaggca
gcaaaagagcttcctggtattcctatagtttttgaaaaacctaaagatcctcatcttttt
atcgaagatgtattccaggcgctatatgcttcaaaaatcattagctatgctcagggattc
atgctgttaaaacaagcgtcagaagagcatcaatggaacctgaatttgggagagttagct
ttattgtggagaggaggatgtattatccaaagcgtatttttagacgctatccacaaaggt
tttgaaaacgaacccgaagcaccttcactaattttacaaacttatttcaaatccacattg
caaaactctgaatccggatggcgtagaacgattgcttatgcaattggctcaggatatcct
gtaccttgtttagcagctgctttgacattctatgatggttaccgaacaaaagattcctca
atagccttagctcaaggattgcgagattatttcggagcgcactcgtatgaacgtaaggat
aggcctcgaggagaattctaccacacagattggataggcactaagactacaacgcttgta
aaataa

DBGET integrated database retrieval system